Takifugu flavidus (sansaifugu): 130517959 Help Entry 130517959         CDS       T09160                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04382   Cornified envelope formation tfs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfs00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     130517959 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130517959 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130517959 (s100a10a) Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of microglial cells    130517959 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH Astro_p19 NNH2 Motif Other DBs NCBI-GeneID:  130517959 NCBI-ProteinID:  XP_056876177 LinkDB All DBs Position 21:8024691..8026324 Genome browser AA seq 100 aa AA seqDB search MPSELEIAMESLIKVFHRYASKEGRSGTLSRRELRELMENELTNFLRSQKDPAAVDKIMR DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQTHMRKSGRM NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcggaactggagatagcaatggagtcactcatcaaagtgttccaccgttacgcc tccaaggagggtcggagcggcaccctcagccggcgggagctccgggagctgatggagaac gagctgaccaacttcctgcggtctcagaaggaccccgctgcggtcgataaaatcatgagg gacctggacaccaacggcgacggccaggtggattttgaagagttcgtgtctctggttgtc ggactgtccatcgcttgtgagcagtgctatcagacgcacatgaggaagagcgggaggatg taa

DBGET integrated database retrieval system