Takifugu flavidus (sansaifugu): 130519002 Help Entry 130519002         CDS       T09160                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs03030   DNA replication tfs03082   ATP-dependent chromatin remodeling tfs03410   Base excision repair tfs03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tfs00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     130519002 (pole3)    03410 Base excision repair     130519002 (pole3)    03420 Nucleotide excision repair     130519002 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     130519002 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tfs03032]     130519002 (pole3)    03036 Chromosome and associated proteins [BR:tfs03036]     130519002 (pole3)    03400 DNA repair and recombination proteins [BR:tfs03400]     130519002 (pole3) Enzymes [BR:tfs01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      130519002 (pole3) DNA replication proteins [BR:tfs03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     130519002 (pole3) Chromosome and associated proteins [BR:tfs03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     130519002 (pole3) DNA repair and recombination proteins [BR:tfs03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       130519002 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase DUF3276 Afi1 AAA_11 DMP19 Motif Other DBs NCBI-GeneID:  130519002 NCBI-ProteinID:  XP_056878001 LinkDB All DBs Position 2:9813237..9815108 Genome browser AA seq 144 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLKEALEVYKKGQKGKKEVSEQKRKDKEKKNSEIDKS REEEEEEEEERMLEEPEVEEDVES NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaagacctgaatcttcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggagtgaatgtgtcaaaagaggccagaagagccatatctcaagct gccagtgtctttgtgctgtatgcaacatcctgtgcaaacaactttgcaatgaaggccaaa cggaaaactctgaatgcaggagatgttttagctgccatggaagagatggaatttgaacga ttcctggagcctcttaaagaagctttggaggtgtacaagaagggccagaaaggaaaaaag gaagtgtccgagcagaagcgcaaagacaaagagaagaaaaacagtgagattgataagagc agagaagaggaggaggaagaagaggaagagcgcatgttagaggagcctgaggtagaggag gatgtggaaagctga

DBGET integrated database retrieval system