Takifugu flavidus (sansaifugu): 130521458 Help Entry 130521458         CDS       T09160                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04137   Mitophagy - animal tfs04140   Autophagy - animal tfs04218   Cellular senescence tfs04371   Apelin signaling pathway tfs04625   C-type lectin receptor signaling pathway tfs04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130521458 (rras2)    04371 Apelin signaling pathway     130521458 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130521458 (rras2)    04137 Mitophagy - animal     130521458 (rras2)   09143 Cell growth and death    04218 Cellular senescence     130521458 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130521458 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130521458 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130521458 (rras2)    04031 GTP-binding proteins [BR:tfs04031]     130521458 (rras2) Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130521458 (rras2)   Exosomal proteins of bladder cancer cells    130521458 (rras2) GTP-binding proteins [BR:tfs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130521458 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase SLFN-g3_helicase CTD10 Motif Other DBs NCBI-GeneID:  130521458 NCBI-ProteinID:  XP_056881027 LinkDB All DBs Position 2:16563686..16582167 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLEQHRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPKSKEKDKSGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccggctggtggtggtcggaggt ggcggcgttggcaaatcagccctgactatccagttcatccagtcatattttgtaaccgac tatgaccccacgatcgaagactcctataccaagcagtgcgttattgacgaaagggctgcc aggctcgacatcctcgacacggctggacaggaagagttcggagccatgagagaacaatac atgcggacaggggagggcttcctgctcgtcttctcggtcaccgacagagggagctttgag gaaatctacaaattccaaagacaaatcctgcgagtaaaagacagagatgaatttcccatg atcctcgtaggaaataaagcggatctggagcagcacagacaagtaacccaggaagagggc cagcaactcgccagacaactcaaggtcacgtatatggaggcttcagccaaaatccgaatg aacgtagaccaggctttccacgaactggttcgagtcatcaggaaattccaggagcaggaa tgtccaccgtcaccagagccgaaaagcaaagagaaggacaagagcggctgccactgcgtg atcttctga

DBGET integrated database retrieval system