Takifugu flavidus (sansaifugu): 130521458 Help Entry 130521458         CDS       T09160                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04137   Mitophagy - animal tfs04140   Autophagy - animal tfs04218   Cellular senescence tfs04371   Apelin signaling pathway tfs04519   Cadherin signaling tfs04625   C-type lectin receptor signaling pathway tfs04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130521458 (rras2)    04371 Apelin signaling pathway     130521458 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     130521458 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130521458 (rras2)    04137 Mitophagy - animal     130521458 (rras2)   09143 Cell growth and death    04218 Cellular senescence     130521458 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130521458 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130521458 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130521458 (rras2)    04031 GTP-binding proteins [BR:tfs04031]     130521458 (rras2) Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130521458 (rras2)   Exosomal proteins of bladder cancer cells    130521458 (rras2) GTP-binding proteins [BR:tfs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130521458 (rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase RHG35-p190PhoGP_pG1 CTD10 Motif Other DBs NCBI-GeneID:  130521458 NCBI-ProteinID:  XP_056881027 LinkDB All DBs Position 2:16563686..16582167 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLEQHRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPKSKEKDKSGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccggctggtggtggtcggaggt ggcggcgttggcaaatcagccctgactatccagttcatccagtcatattttgtaaccgac tatgaccccacgatcgaagactcctataccaagcagtgcgttattgacgaaagggctgcc aggctcgacatcctcgacacggctggacaggaagagttcggagccatgagagaacaatac atgcggacaggggagggcttcctgctcgtcttctcggtcaccgacagagggagctttgag gaaatctacaaattccaaagacaaatcctgcgagtaaaagacagagatgaatttcccatg atcctcgtaggaaataaagcggatctggagcagcacagacaagtaacccaggaagagggc cagcaactcgccagacaactcaaggtcacgtatatggaggcttcagccaaaatccgaatg aacgtagaccaggctttccacgaactggttcgagtcatcaggaaattccaggagcaggaa tgtccaccgtcaccagagccgaaaagcaaagagaaggacaagagcggctgccactgcgtg atcttctga

DBGET integrated database retrieval system