Takifugu flavidus (sansaifugu): 130524329 Help Entry 130524329         CDS       T09160                                  Symbol myl2a Name (RefSeq) myosin regulatory light chain 2a   KO K10351   myosin regulatory light chain 2 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04260   Cardiac muscle contraction tfs04261   Adrenergic signaling in cardiomyocytes tfs04371   Apelin signaling pathway tfs04510   Focal adhesion tfs04520   Adherens junction tfs04530   Tight junction tfs04810   Regulation of actin cytoskeleton tfs04814   Motor proteins tfs04820   Cytoskeleton in muscle cells tfs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     130524329 (myl2a)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     130524329 (myl2a)    04520 Adherens junction     130524329 (myl2a)    04530 Tight junction     130524329 (myl2a)   09142 Cell motility    04814 Motor proteins     130524329 (myl2a)    04820 Cytoskeleton in muscle cells     130524329 (myl2a)    04810 Regulation of actin cytoskeleton     130524329 (myl2a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     130524329 (myl2a)    04261 Adrenergic signaling in cardiomyocytes     130524329 (myl2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130524329 (myl2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tfs04812]     130524329 (myl2a) Cytoskeleton proteins [BR:tfs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      130524329 (myl2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  130524329 NCBI-ProteinID:  XP_056886340 LinkDB All DBs Position 4:complement(4365341..4367350) Genome browser AA seq 169 aa AA seqDB search MAPKKAKRRTAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRL NVKQEELDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLRKDYV TQMLTTQADRFSKEEMDQMFTAFPPDVAGNLDYKNLVHIITHGEEKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcccccaagaaagccaagaggaggacggcggagggagccaactcgaacgtgttctcc atgtttgagcaggcgcagatccaggagtttaaagaggccttcaccatcatggaccagaac agagatggcttcattgacaagaatgatttgagggacacttttgctgctctcggacgtctc aatgtcaaacaggaggagctggacgagatgctgaaggaggctcctggtcccatcaatttc acagtcttcctaactatgtttggcgagaagctgaaaggtgctgatccagaggaaaccatt ctcaatgcctttaaggtgtttgacccagagggaaaaggagtcttgaggaaggactacgtc acacagatgttgacaacacaagcagatcggttctctaaagaagagatggatcagatgttc actgccttccccccagatgtggctggaaacctggactacaagaacctggttcacatcatc actcacggagaggaaaaagaccaggagtga

DBGET integrated database retrieval system