Takifugu flavidus (sansaifugu): 130532042 Help Entry 130532042         CDS       T09160                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04382   Cornified envelope formation tfs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfs00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     130532042 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130532042 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130532042 (s100a10b) Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of microglial cells    130532042 (s100a10b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 SPARC_Ca_bdg EF-hand_8 EF-hand_6 EF-hand_FSTL1 LON_substr_bdg EF-hand_5 Motif Other DBs NCBI-GeneID:  130532042 NCBI-ProteinID:  XP_056900262 LinkDB All DBs Position 10:complement(1943465..1944697) Genome browser AA seq 98 aa AA seqDB search MTELEKCMESLISTFHRYAEAGGDGNTLSKKELKKLLENELPSFLKAQNNPKLVDWMMKD LDLNKDDKLDFEEFLPLIVGLSLACEKCYVRTQKKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgagctggagaaatgcatggagtctctgatttccacttttcaccgctatgcggag gcaggcggggatggaaacacgttaagcaagaaggaacttaagaaactacttgaaaacgag ctacccagcttcctcaaagcccagaataaccccaaactggtggactggatgatgaaagat ttggatcttaacaaagacgataagttggactttgaagagtttcttcccctcatcgtcggc ttgtcgctggcgtgcgagaagtgctacgttcgcactcagaagaagggcaagaagtga

DBGET integrated database retrieval system