Takifugu flavidus (sansaifugu): 130533045 Help Entry 130533045         CDS       T09160                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04144   Endocytosis tfs04370   VEGF signaling pathway tfs04510   Focal adhesion tfs04520   Adherens junction tfs04530   Tight junction tfs04810   Regulation of actin cytoskeleton tfs04912   GnRH signaling pathway tfs05100   Bacterial invasion of epithelial cells tfs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130533045 (cdc42l)    04370 VEGF signaling pathway     130533045 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130533045 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130533045 (cdc42l)    04520 Adherens junction     130533045 (cdc42l)    04530 Tight junction     130533045 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130533045 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     130533045 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130533045 (cdc42l)    05100 Bacterial invasion of epithelial cells     130533045 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfs04131]     130533045 (cdc42l)    03036 Chromosome and associated proteins [BR:tfs03036]     130533045 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfs04147]     130533045 (cdc42l)    04031 GTP-binding proteins [BR:tfs04031]     130533045 (cdc42l) Membrane trafficking [BR:tfs04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130533045 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     130533045 (cdc42l)   Macropinocytosis    Ras GTPases     130533045 (cdc42l) Chromosome and associated proteins [BR:tfs03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     130533045 (cdc42l) Exosome [BR:tfs04147]  Exosomal proteins   Exosomal proteins of microglial cells    130533045 (cdc42l)   Exosomal proteins of breast milk    130533045 (cdc42l) GTP-binding proteins [BR:tfs04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130533045 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  130533045 NCBI-ProteinID:  XP_056902163 LinkDB All DBs Position 10:734685..738831 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDGSTIEKLAKNKQRPLYPESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaactataaaatgcgtggtggtgggggacggtgccgtaggaaagacctgcttactg atctcctacacaaccaataagttcccctctgaatatgtacctacggtttttgacaattat gccgtgacggtgatgatcgggggggagccctacacactgggcctatttgatacagcagga caggaagattatgaccgtctgcgtcctctcagttatccacaaacagacgtgttcctcgta tgtttctctgtcgtctcaccctcgtcatttgaaaacgtcaaagagaagtgggttcctgag atctcccatcactgcccacggacaccgttcctgctagtggggacacaagtggacctgcgg gaagatggcagcaccattgaaaagcttgcaaagaacaaacagcgccccctgtatcctgaa agtggcgagaaactggcacgtgaactccgggctgtcaaatacgtggagtgctctgctctg acacagcgaggtcttaaaaatgtgttcgacgaggccattctggctgctttggagccccct gagaccaaaaccaagagaaagtgcatcctgctatag

DBGET integrated database retrieval system