KEGG   Takifugu flavidus (sansaifugu): 130537252
Entry
130537252         CDS       T09160                                 
Symbol
skp1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
tfs  Takifugu flavidus (sansaifugu)
Pathway
tfs03083  Polycomb repressive complex
tfs04110  Cell cycle
tfs04114  Oocyte meiosis
tfs04120  Ubiquitin mediated proteolysis
tfs04141  Protein processing in endoplasmic reticulum
tfs04310  Wnt signaling pathway
tfs04350  TGF-beta signaling pathway
tfs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:tfs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    130537252 (skp1)
   04120 Ubiquitin mediated proteolysis
    130537252 (skp1)
  09126 Chromosome
   03083 Polycomb repressive complex
    130537252 (skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    130537252 (skp1)
   04350 TGF-beta signaling pathway
    130537252 (skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    130537252 (skp1)
   04114 Oocyte meiosis
    130537252 (skp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    130537252 (skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tfs04131]
    130537252 (skp1)
   04121 Ubiquitin system [BR:tfs04121]
    130537252 (skp1)
   03036 Chromosome and associated proteins [BR:tfs03036]
    130537252 (skp1)
Membrane trafficking [BR:tfs04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    130537252 (skp1)
Ubiquitin system [BR:tfs04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     130537252 (skp1)
   Cul7 complex
     130537252 (skp1)
Chromosome and associated proteins [BR:tfs03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     130537252 (skp1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     130537252 (skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 130537252
NCBI-ProteinID: XP_056909899
LinkDB
Position
14:11850017..11852407
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDDGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccacgataaagctgcagagctccgatggggagatcttcgaggtggatgtcgagata
gccaaacagtccgtcaccattaagaccatgttggaagatttggggatggatgatgatgga
gatgatgatccggttccacttcctaatgtgaacgcagccatcctgaagaaggtcattcag
tggtgcacccaccacaaagatgaccccccaccccccgaggacgacgaaaacaaggagaag
aggacggacgacattcccgtctgggaccaggagttcctcaaagtggaccaaggcaccttg
tttgagcttattctggcggccaattacctggacattaaaggcctgttagacgtcacctgc
aagacggtggccaacatgatcaaaggaaagacccccgaggagatcaggaagaccttcaac
atcaaaaacgacttcacggaggaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system