Takifugu flavidus (sansaifugu): 130537252
Help
Entry
130537252 CDS
T09160
Symbol
skp1
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
tfs
Takifugu flavidus (sansaifugu)
Pathway
tfs03083
Polycomb repressive complex
tfs04110
Cell cycle
tfs04114
Oocyte meiosis
tfs04120
Ubiquitin mediated proteolysis
tfs04141
Protein processing in endoplasmic reticulum
tfs04310
Wnt signaling pathway
tfs04350
TGF-beta signaling pathway
tfs05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
tfs00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
130537252 (skp1)
04120 Ubiquitin mediated proteolysis
130537252 (skp1)
09126 Chromosome
03083 Polycomb repressive complex
130537252 (skp1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
130537252 (skp1)
04350 TGF-beta signaling pathway
130537252 (skp1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
130537252 (skp1)
04114 Oocyte meiosis
130537252 (skp1)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
130537252 (skp1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
tfs04131
]
130537252 (skp1)
04121 Ubiquitin system [BR:
tfs04121
]
130537252 (skp1)
03036 Chromosome and associated proteins [BR:
tfs03036
]
130537252 (skp1)
Membrane trafficking [BR:
tfs04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
130537252 (skp1)
Ubiquitin system [BR:
tfs04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
130537252 (skp1)
Cul7 complex
130537252 (skp1)
Chromosome and associated proteins [BR:
tfs03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
130537252 (skp1)
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
130537252 (skp1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
130537252
NCBI-ProteinID:
XP_056909899
LinkDB
All DBs
Position
14:11850017..11852407
Genome browser
AA seq
163 aa
AA seq
DB search
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDDGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgcccacgataaagctgcagagctccgatggggagatcttcgaggtggatgtcgagata
gccaaacagtccgtcaccattaagaccatgttggaagatttggggatggatgatgatgga
gatgatgatccggttccacttcctaatgtgaacgcagccatcctgaagaaggtcattcag
tggtgcacccaccacaaagatgaccccccaccccccgaggacgacgaaaacaaggagaag
aggacggacgacattcccgtctgggaccaggagttcctcaaagtggaccaaggcaccttg
tttgagcttattctggcggccaattacctggacattaaaggcctgttagacgtcacctgc
aagacggtggccaacatgatcaaaggaaagacccccgaggagatcaggaagaccttcaac
atcaaaaacgacttcacggaggaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga
DBGET
integrated database retrieval system