Takifugu flavidus (sansaifugu): 130537346 Help Entry 130537346         CDS       T09160                                  Name (RefSeq) insulin   KO K04526   insulin Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04068   FoxO signaling pathway tfs04081   Hormone signaling tfs04114   Oocyte meiosis tfs04140   Autophagy - animal tfs04150   mTOR signaling pathway tfs04810   Regulation of actin cytoskeleton tfs04910   Insulin signaling pathway tfs04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     130537346    04150 mTOR signaling pathway     130537346   09133 Signaling molecules and interaction    04081 Hormone signaling     130537346  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130537346  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfs04052]     130537346 Cytokines and neuropeptides [BR:tfs04052]  Neuropeptides   Unclassified    130537346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  130537346 NCBI-ProteinID:  XP_056910059 LinkDB All DBs Position 14:complement(15433165..15434380) Genome browser AA seq 114 aa AA seqDB search MAALWLQSVSLLLLMVVSSPGSQAMAPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDSM MGFLPPKAGGAAGVDNEVAEYAFKDQMEMMVKRGIVEQCCLRPCNLLDLQNYCN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggcggctctctggctccagtctgtctctctgctgctcttaatggttgtatcgtcaccg ggctctcaggccatggctcctccacagcacctgtgtgggtctcacctggtcgatgccctt tacctggtgtgtggtgacagaggattcttctacaaccccaagagagacgtggactccatg atgggatttctccctccaaaggcaggcggagcagcaggcgtcgataatgaggtggctgaa tacgcgttcaaagaccagatggagatgatggtgaagcgaggcattgtggaacagtgctgc ctcaggccctgcaacctcctcgacctgcagaactactgcaactga

DBGET integrated database retrieval system