Tsuneonella flava: IDJ81_11500 Help Entry IDJ81_11500       CDS       T07616                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tfv  Tsuneonella flava Pathway tfv01100   Metabolic pathways tfv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tfv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IDJ81_11500    00074 Mycolic acid biosynthesis     IDJ81_11500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IDJ81_11500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSB43965 LinkDB All DBs Position 2449556..2449846 Genome browser AA seq 96 aa AA seqDB search MSNGHDLAPSRAAIDAKLRKILSDVLGLAADDVAAFDANTGLFGHLPELDSMAVAGLLTE MEDQLDIIIEDDDVDGEMLETYGGLLAFAEAKAVEA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcgaatggtcacgatctcgcaccaagccgcgccgcgatcgacgcgaagcttcgtaag atattgtccgatgtacttggtttggcagcagatgatgtcgcggcgttcgatgccaacaca ggtcttttcggtcacctgccggagctggattcgatggcggtcgccggtttactgaccgaa atggaagatcagctcgacatcataatcgaagacgacgatgtcgatggcgagatgctggaa acttatggcggattactcgcctttgccgaggctaaagcggtcgaggcgtga

DBGET integrated database retrieval system