KEGG   Torulaspora globosa: HG536_0A07040
Entry
HG536_0A07040     CDS       T06981                                 
Name
(RefSeq) uncharacterized protein
  KO
K12575  kinetochore protein SLK19
Organism
tgb  Torulaspora globosa
Pathway
tgb04111  Cell cycle - yeast
tgb04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tgb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    HG536_0A07040
   04113 Meiosis - yeast
    HG536_0A07040
SSDB
Motif
Pfam: Fungal_TACC ERM_helical FUSC
Other DBs
NCBI-GeneID: 59323986
NCBI-ProteinID: XP_037137564
LinkDB
Position
1:1257299..1259653
AA seq 784 aa
MEGEVAMDDFPTTPLREGMPTGHNGSRKNEVVLQGEHLKAHPHGLSAKRRLEKDIGEESC
AGLKELSDESLDCVRRSQEGQRDVSACRNEQKNPLDQIDINRMFSGTQDAAEAADDSTIF
VKHSPIRFDMSSPVKHNAGKEEDGQQPKRLKLELECVPNLGQPGGVNGAVDEEPPVGSPE
AIEMIEAKSSPMKDFSQVAYEADHNGNNGLCDELASGANTTPGRPSSCLHTLSPVHHSAD
ANGEQFVLELDENDDGQEMFQMLTTRNEELIRQVHVLNQKLNKMMTTCDITSYRYKKMQS
DLQPLLKDCQAKLNESYKELQVVTEERDSLRERTVKLKERIDENRDEVKMLNQNQSILQK
KYISLMNEIESARNKYEELESKHRNLEEQHNEDEKRKQILNDRIDEMAAQISGISAENTN
LKKLNEDLIIEVKSVEEELDTKTNEVRKLQEQLQEAVDAEKGANDQVAKRINELVAQRAD
LESQFENYKAKSETGNKELVARVREAEDRLDRKVSEVQSLQDKLNKMVQDGLVKDTLIKE
LKRKLEEANDKSEIDKAQVTELQNGKAELERINGCMESSIAELEESLREWQAKYDEQAEK
QKLSVELEAIQLKNSNIEAEHLAELEQLHSNLSALQEDLKQNSKIIGELRDENESLRRTK
QSIEAKLEETLQKEATNEDQDLVKSLQKELESWKEKYQLKEQESNRSLKLLAEDLYVQYS
SKHEQKVKLLKKGYETKFQGKLDKLMLQNEGLTQEIEQVKSNLAAERKEKQKLIDLLESR
KPQE
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggagggtgaggttgcgatggatgactttccgaccactccgctgcgtgaagggatgcct
acagggcacaatggctcgagaaagaatgaggtggttttgcaaggtgaacatttgaaagcg
cacccgcatggcctatcggcaaagaggagactggagaaagatattggagaagaaagttgt
gctggtttgaaagagctatcagatgagtctttggattgtgttcgaaggagtcaggaaggg
cagcgagatgtgtcagcttgccgaaatgagcagaagaacccgttggatcagatcgatatc
aataggatgttctccggaactcaggatgcagctgaagctgcagacgattcgaccattttt
gtgaaacactcgccgataaggttcgatatgagctcacccgtgaagcataacgcgggtaaa
gaagaggacggccaacagcctaagagactcaaactggagctggaatgcgttccgaatttg
ggacagccgggtggtgtaaatggtgctgtcgatgaagagcctcctgtgggctcaccagaa
gcgatagagatgatagaggccaagagcagtcccatgaaggatttcagccaagtggcctac
gaggctgatcacaacgggaacaatgggctttgtgatgagctggcaagcggggcgaataca
acaccagggcgccccagttcttgtctgcatactttgagtcccgttcatcacagcgctgat
gcaaatggtgaacagtttgtattagaattagacgagaatgatgatgggcaagaaatgttt
cagatgcttacgactagaaatgaggagctgatcaggcaggttcatgtgctaaaccagaaa
ttgaacaagatgatgacgacctgtgatattacgtcttaccgttacaaaaaaatgcaaagt
gatttgcagccacttttaaaagattgtcaagcaaaattgaatgaaagctataaagaattg
caggttgttactgaagagcgtgatagccttagagagaggacggttaagcttaaagagcga
attgacgaaaatcgggatgaggttaagatgctgaatcaaaaccaatccatattgcaaaag
aaatatattagcttgatgaatgagatagaaagtgcaaggaataaatatgaagagcttgag
tccaaacatagaaatctggaggagcaacataacgaagacgaaaaacgaaaacaaattctg
aacgatcggatcgatgaaatggcggcgcaaatatccggaatatctgccgaaaatacgaac
ctaaagaaactcaatgaagatttaatcatagaggtaaagtctgttgaagaagaactcgat
accaagacgaacgaagtaagaaaattacaagagcaattgcaggaagcggtagatgcagaa
aaaggtgccaatgatcaggtagcgaagcgaataaatgaattggtagcacagagggcagat
ttagagagtcaattcgagaactacaaggccaaatcagaaacaggaaacaaggagctagta
gcgcgcgtcagagaggctgaagatcgcttagacaggaaggttagtgaggtgcaaagtctc
caagacaagctaaacaaaatggtgcaagatggattggtgaaggatacacttataaaagag
ctgaaaaggaaacttgaagaagctaatgataagtctgagatagataaggcacaggtcacg
gagctacaaaatggaaaagcggagctagagcgtatcaatggatgcatggaaagctccatt
gccgaattggaagaaagtctcagggaatggcaggcgaaatacgacgagcaagctgaaaaa
cagaagttatccgttgagctagaagccatccaactgaaaaacagcaacattgaggcagaa
cacttggccgaattagagcagctgcattccaatttgagtgccttgcaagaagacctgaaa
caaaattcaaaaattattggcgaattgagagatgagaatgaatcgctacggcgaacaaag
cagtcgatcgaggccaagctcgaagaaaccctacagaaagaagcaactaacgaagaccaa
gatcttgtgaaatcgttacaaaaagagctggaatcatggaaggagaagtaccagctgaaa
gaacaagaatcaaacagatctctcaagctacttgctgaggatctttacgttcagtactcc
tcaaagcatgaacaaaaagtgaagcttttgaagaaaggctacgaaacaaagtttcaaggt
aaactcgacaagttaatgctgcagaacgaaggcctcacccaagagattgagcaagtaaaa
tcaaatttggctgcagaaaggaaggagaaacaaaagttgattgatttgctcgagagcaga
aaaccgcaagaataa

DBGET integrated database retrieval system