Torulaspora globosa: HG536_0D02820 Help Entry HG536_0D02820     CDS       T06981                                  Name (RefSeq) uncharacterized protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism tgb  Torulaspora globosa Pathway tgb03018   RNA degradation tgb03040   Spliceosome Brite KEGG Orthology (KO) [BR:tgb00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     HG536_0D02820   09123 Folding, sorting and degradation    03018 RNA degradation     HG536_0D02820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tgb03019]     HG536_0D02820    03041 Spliceosome [BR:tgb03041]     HG536_0D02820 Messenger RNA biogenesis [BR:tgb03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      HG536_0D02820   mRNA degradation factors    5'-3' decay     Lsm complex      HG536_0D02820 Spliceosome [BR:tgb03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     HG536_0D02820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Hfq Hfq_1 Motif Other DBs NCBI-GeneID:  59325927 NCBI-ProteinID:  XP_037139434 UniProt:  A0A7G3ZGX4 LinkDB All DBs Position 4:complement(497760..498095) Genome browser AA seq 111 aa AA seqDB search MPQETQQPQQQRRKFEGPKREAILDLAKYKDTKVRVKLMGGRLVTGVLKGYDQLMNLVLD ETLEYMRDPEDSSVILKDKTRSLGLIVIRGTVLLSLSPCDGSEVIYVQESN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgccccaggaaacacagcaaccacagcagcaaagacgcaagttcgagggccccaagagg gaggcaatccttgacttggccaagtacaaagataccaaggtccgcgtgaagcttatgggc gggaggctggtaacaggcgtgctgaaaggttacgatcaactgatgaacctggtgctggac gagactctggagtatatgcgcgaccccgaagattcgtctgttattctgaaagataagacg agaagtctgggactgattgtcatcagaggcactgtcctgctgtcgctcagcccatgcgac ggatccgaggttatctacgtccaggaaagtaactga

DBGET integrated database retrieval system