Torulaspora globosa: HG536_0H04490 Help Entry HG536_0H04490     CDS       T06981                                  Name (RefSeq) uncharacterized protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism tgb  Torulaspora globosa Pathway tgb03020   RNA polymerase tgb03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tgb00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HG536_0H04490   09124 Replication and repair    03420 Nucleotide excision repair     HG536_0H04490  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tgb03021]     HG536_0H04490    03400 DNA repair and recombination proteins [BR:tgb03400]     HG536_0H04490 Transcription machinery [BR:tgb03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      HG536_0H04490 DNA repair and recombination proteins [BR:tgb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       HG536_0H04490 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Thymidylate_kin Motif Other DBs NCBI-GeneID:  59328339 NCBI-ProteinID:  XP_037141747 UniProt:  A0A7G3ZNI7 LinkDB All DBs Position 8:complement(798803..799171) Genome browser AA seq 122 aa AA seqDB search MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVISFEKEDHTLGNLIRAELLNDRKVLFAA YKVEHPLFARFKMRIQTVEGYDPKDALKNACNSIINKLAVLKTNFETEWNLQTLASDDNY GI NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaacgccccagatagattcgagctttttttgttgggagaaggtgagtcgaaactaaaa atcgaaccggataccaaggcaccaaacgctgtggtgatttctttcgagaaggaagaccat acgctgggcaacttaataagagcggaactgctgaacgataggaaagtactgtttgctgcc tacaaagttgagcatccgctgtttgcccgcttcaagatgaggatacaaactgtcgaaggt tatgatcctaaggacgcactaaaaaatgcttgcaatagcataattaataagcttgcggta ttgaaaaccaattttgaaacggagtggaatttacagacacttgcatctgatgacaattat ggcatatga

DBGET integrated database retrieval system