Theropithecus gelada (gelada): 112604626 Help Entry 112604626         CDS       T08041                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism tge  Theropithecus gelada (gelada) Pathway tge04015   Rap1 signaling pathway tge04810   Regulation of actin cytoskeleton tge05014   Amyotrophic lateral sclerosis tge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112604626 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112604626 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112604626 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112604626 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112604626 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tge04812]     112604626 (PFN4)    04147 Exosome [BR:tge04147]     112604626 (PFN4) Membrane trafficking [BR:tge04131]  Others   Actin-binding proteins    Others     112604626 (PFN4) Cytoskeleton proteins [BR:tge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112604626 (PFN4) Exosome [BR:tge04147]  Exosomal proteins   Proteins found in most exosomes    112604626 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112604626 NCBI-ProteinID:  XP_025209588 Ensembl:  ENSTGEG00000019430 UniProt:  A0A8D2FHY7 LinkDB All DBs Position 13:complement(44457296..44465036) Genome browser AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCAASPGFNVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYRCVRADEYSLYAKNENAGVVVVKTHLYLLVATYTEGMYPSVCVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcctgtgtgcagcatcaccaggttttaatgta atgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaaacccga agagaaggattgtatttcaaggaaaaggattatagatgtgtccgggcagatgaatattct ctttatgccaaaaatgagaacgctggtgtggttgtcgtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttga

DBGET integrated database retrieval system