Theropithecus gelada (gelada): 112605068 Help Entry 112605068         CDS       T08041                                  Symbol APOA2 Name (RefSeq) apolipoprotein A-II   KO K08758   apolipoprotein A-II Organism tge  Theropithecus gelada (gelada) Pathway tge03320   PPAR signaling pathway tge04979   Cholesterol metabolism Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     112605068 (APOA2)   09154 Digestive system    04979 Cholesterol metabolism     112605068 (APOA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112605068 (APOA2) Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of other cancer cells    112605068 (APOA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ApoA-II Motif Other DBs NCBI-GeneID:  112605068 NCBI-ProteinID:  XP_025210440 Ensembl:  ENSTGEG00000007421 LinkDB All DBs Position 1:complement(26735340..26736656) Genome browser AA seq 100 aa AA seqDB search MKLLAATVLLLTICSLEGALVRRQAEEPSVETLVSQYFQTVTDYGKDLMEKVKSPELQAQ AKAYFEKSKEQLTPLVKKAGTDLVNFLSYFVELRTQPATQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagctgcttgcagcaactgtgctgctcctcaccatctgcagccttgaaggagctttg gttcggagacaggcagaggaaccaagtgtggagaccctggtttctcagtacttccagact gtgactgactacggcaaggacctgatggagaaggtcaagagcccagagcttcaggcccag gccaaggcttactttgaaaagtcaaaggagcagctgacacctctggtcaagaaggctgga acggatctggttaacttcttgagctatttcgtggaacttagaacgcagcctgccacccag tga

DBGET integrated database retrieval system