Theropithecus gelada (gelada): 112608255 Help Entry 112608255         CDS       T08041                                  Name (RefSeq) interferon alpha-2   KO K05414   interferon alpha Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04151   PI3K-Akt signaling pathway tge04217   Necroptosis tge04620   Toll-like receptor signaling pathway tge04621   NOD-like receptor signaling pathway tge04622   RIG-I-like receptor signaling pathway tge04623   Cytosolic DNA-sensing pathway tge04630   JAK-STAT signaling pathway tge04650   Natural killer cell mediated cytotoxicity tge04936   Alcoholic liver disease tge05152   Tuberculosis tge05160   Hepatitis C tge05161   Hepatitis B tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05165   Human papillomavirus infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05168   Herpes simplex virus 1 infection tge05169   Epstein-Barr virus infection tge05170   Human immunodeficiency virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05200   Pathways in cancer tge05320   Autoimmune thyroid disease tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112608255    04151 PI3K-Akt signaling pathway     112608255   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112608255  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112608255  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112608255    04621 NOD-like receptor signaling pathway     112608255    04622 RIG-I-like receptor signaling pathway     112608255    04623 Cytosolic DNA-sensing pathway     112608255    04650 Natural killer cell mediated cytotoxicity     112608255  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112608255   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112608255    05161 Hepatitis B     112608255    05160 Hepatitis C     112608255    05171 Coronavirus disease - COVID-19     112608255    05164 Influenza A     112608255    05162 Measles     112608255    05168 Herpes simplex virus 1 infection     112608255    05163 Human cytomegalovirus infection     112608255    05167 Kaposi sarcoma-associated herpesvirus infection     112608255    05169 Epstein-Barr virus infection     112608255    05165 Human papillomavirus infection     112608255   09171 Infectious disease: bacterial    05152 Tuberculosis     112608255   09163 Immune disease    05320 Autoimmune thyroid disease     112608255   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112608255   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112608255  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112608255 Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interferons    112608255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Spo16_N CoV_NSP2_N Motif Other DBs NCBI-GeneID:  112608255 NCBI-ProteinID:  XP_025215833 Ensembl:  ENSTGEG00000013238 UniProt:  A0A8D2F6J0 LinkDB All DBs Position 15:60427511..60428636 Genome browser AA seq 188 aa AA seqDB search MALTFALLVALVVLSCKSSCSLGCDLPQTHSLGNRRTLMLLARMRRISLFFCLKDRHDFE FPQEEFGNQFQKAQTIPVLHEMIQQTFNLFSTKDSSAAWDETLLNKFYTELYQQLNDLEA CVMQEMGVTETSLMNKNSILAVRKYFQRLTLYLKEKKYSLCAWEVVRAEIMRSFSLSTNL QESLRSKE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccttgacctttgctttactggtggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctacctcaaacccacagcctgggtaacaggaggaccttgatgctc ctggcacgaatgaggagaatctctcttttcttctgcctgaaggacagacatgactttgaa tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat gagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgggat gagaccctcctaaacaaattctacactgaactctaccagcagctgaatgacctggaagcc tgtgtgatgcaggagatgggggtgacagagacttccctgatgaacaagaactccatcctg gccgtgaggaaatacttccaaagactcactctctatctgaaagagaagaaatacagtctt tgtgcctgggaggttgtcagagcagaaattatgagatctttttctttgtcaacaaacttg caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system