Theropithecus gelada (gelada): 112608386 Help Entry 112608386         CDS       T08041                                  Symbol TXN Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism tge  Theropithecus gelada (gelada) Pathway tge04621   NOD-like receptor signaling pathway tge05012   Parkinson disease tge05132   Salmonella infection tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112608386 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112608386 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     112608386 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112608386 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tge03110]     112608386 (TXN) Chaperones and folding catalysts [BR:tge03110]  Protein folding catalysts   Protein disulfide isomerase    112608386 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  112608386 NCBI-ProteinID:  XP_025216052 Ensembl:  ENSTGEG00000028883 UniProt:  A0A8D2GKE5 LinkDB All DBs Position 15:30891866..30904841 Genome browser AA seq 105 aa AA seqDB search MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaaggctgcttttcaggaagccttgaacaccgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system