KEGG   Theropithecus gelada (gelada): 112609379
Entry
112609379         CDS       T08041                                 
Name
(RefSeq) C-C motif chemokine 23 isoform X1
  KO
K05511  C-C motif chemokine 15/23
Organism
tge  Theropithecus gelada (gelada)
Pathway
tge04060  Cytokine-cytokine receptor interaction
tge04061  Viral protein interaction with cytokine and cytokine receptor
tge04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112609379
   04061 Viral protein interaction with cytokine and cytokine receptor
    112609379
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    112609379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:tge04052]
    112609379
Cytokines and neuropeptides [BR:tge04052]
 Cytokines
  Chemokines
   112609379
SSDB
Motif
Pfam: IL8 TtuA_LIM_N
Other DBs
NCBI-GeneID: 112609379
NCBI-ProteinID: XP_025217816
Ensembl: ENSTGEG00000017339
UniProt: A0A8D2FJD9
LinkDB
Position
16:complement(10011201..10016152)
AA seq 137 aa
MKVSVAVLSCLMLVTALGSQAKVTNDAETGFMMPKLSLANPEVLDMLWRRKIGPQTTLSL
VAGFHAINADCCTSYIPGSIPCSLLESYLETSSKCPKPGVIFLTKNGRRLCVSPSNKQVL
ACRIMLKLATRIKARKN
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgtcctctcctgcctcatgcttgttactgcccttggatcccag
gccaaggtcacaaatgatgcagagacagggttcatgatgccaaagctttcactggcaaat
ccagaagttctggacatgctctggaggagaaagattggtcctcaaacgaccctttctctt
gttgcaggctttcacgctattaatgctgactgctgcacctcctacatcccaggaagcatc
ccgtgttcactcttggagagttaccttgaaacgagcagcaagtgccccaagccgggtgtc
atcttcctcaccaagaacgggcgacgtttatgtgtcagtcccagtaataagcaagttctg
gcttgcaggataatgctgaagctggccacacggatcaaggccaggaagaactga

DBGET integrated database retrieval system