Theropithecus gelada (gelada): 112609401 Help Entry 112609401         CDS       T08041                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism tge  Theropithecus gelada (gelada) Pathway tge04081   Hormone signaling tge04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     112609401 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     112609401 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112609401 (GAST) Cytokines and neuropeptides [BR:tge04052]  Neuropeptides   GPCR binding    112609401 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  112609401 NCBI-ProteinID:  XP_025217862 LinkDB All DBs Position 16:29724393..29728667 Genome browser AA seq 104 aa AA seqDB search MQQLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRNLELPWLDQQGPASHHRRQL GPQGPPQLVADPSKKQGPWMEEEEAAYGWMDFGRRSAEDENQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcaactgtgtgtgtatgtgctgatctttgcactggctctggctgccttctctgaa gcttcttggaagccccgctcccagcagccagatgcacccttaggtacaggggccaacagg aacctggagctaccctggctggaccagcaaggcccagcctctcaccaccgaaggcagctg ggaccccagggtcccccacaactcgtggcagacccatccaagaagcagggaccatggatg gaggaagaagaagcagcctatggatggatggactttggccgccgcagtgccgaggatgag aaccaacaaccctag

DBGET integrated database retrieval system