Theropithecus gelada (gelada): 112609643 Help Entry 112609643         CDS       T08041                                  Symbol PRKCA Name (RefSeq) protein kinase C alpha type   KO K02677   classical protein kinase C alpha type [EC:2.7.11.13] Organism tge  Theropithecus gelada (gelada) Pathway tge01521   EGFR tyrosine kinase inhibitor resistance tge04010   MAPK signaling pathway tge04012   ErbB signaling pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04020   Calcium signaling pathway tge04066   HIF-1 signaling pathway tge04070   Phosphatidylinositol signaling system tge04071   Sphingolipid signaling pathway tge04072   Phospholipase D signaling pathway tge04082   Neuroactive ligand signaling tge04150   mTOR signaling pathway tge04151   PI3K-Akt signaling pathway tge04261   Adrenergic signaling in cardiomyocytes tge04270   Vascular smooth muscle contraction tge04310   Wnt signaling pathway tge04360   Axon guidance tge04370   VEGF signaling pathway tge04510   Focal adhesion tge04540   Gap junction tge04613   Neutrophil extracellular trap formation tge04650   Natural killer cell mediated cytotoxicity tge04664   Fc epsilon RI signaling pathway tge04666   Fc gamma R-mediated phagocytosis tge04670   Leukocyte transendothelial migration tge04713   Circadian entrainment tge04720   Long-term potentiation tge04723   Retrograde endocannabinoid signaling tge04724   Glutamatergic synapse tge04725   Cholinergic synapse tge04726   Serotonergic synapse tge04727   GABAergic synapse tge04728   Dopaminergic synapse tge04730   Long-term depression tge04750   Inflammatory mediator regulation of TRP channels tge04911   Insulin secretion tge04912   GnRH signaling pathway tge04916   Melanogenesis tge04918   Thyroid hormone synthesis tge04919   Thyroid hormone signaling pathway tge04921   Oxytocin signaling pathway tge04925   Aldosterone synthesis and secretion tge04926   Relaxin signaling pathway tge04928   Parathyroid hormone synthesis, secretion and action tge04929   GnRH secretion tge04933   AGE-RAGE signaling pathway in diabetic complications tge04935   Growth hormone synthesis, secretion and action tge04960   Aldosterone-regulated sodium reabsorption tge04961   Endocrine and other factor-regulated calcium reabsorption tge04970   Salivary secretion tge04971   Gastric acid secretion tge04972   Pancreatic secretion tge05017   Spinocerebellar ataxia tge05022   Pathways of neurodegeneration - multiple diseases tge05031   Amphetamine addiction tge05032   Morphine addiction tge05143   African trypanosomiasis tge05146   Amoebiasis tge05161   Hepatitis B tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05170   Human immunodeficiency virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05200   Pathways in cancer tge05205   Proteoglycans in cancer tge05206   MicroRNAs in cancer tge05207   Chemical carcinogenesis - receptor activation tge05214   Glioma tge05223   Non-small cell lung cancer tge05225   Hepatocellular carcinoma tge05231   Choline metabolism in cancer tge05415   Diabetic cardiomyopathy tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112609643 (PRKCA)    04012 ErbB signaling pathway     112609643 (PRKCA)    04014 Ras signaling pathway     112609643 (PRKCA)    04015 Rap1 signaling pathway     112609643 (PRKCA)    04310 Wnt signaling pathway     112609643 (PRKCA)    04370 VEGF signaling pathway     112609643 (PRKCA)    04066 HIF-1 signaling pathway     112609643 (PRKCA)    04020 Calcium signaling pathway     112609643 (PRKCA)    04070 Phosphatidylinositol signaling system     112609643 (PRKCA)    04072 Phospholipase D signaling pathway     112609643 (PRKCA)    04071 Sphingolipid signaling pathway     112609643 (PRKCA)    04151 PI3K-Akt signaling pathway     112609643 (PRKCA)    04150 mTOR signaling pathway     112609643 (PRKCA)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     112609643 (PRKCA)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     112609643 (PRKCA)    04540 Gap junction     112609643 (PRKCA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112609643 (PRKCA)    04650 Natural killer cell mediated cytotoxicity     112609643 (PRKCA)    04664 Fc epsilon RI signaling pathway     112609643 (PRKCA)    04666 Fc gamma R-mediated phagocytosis     112609643 (PRKCA)    04670 Leukocyte transendothelial migration     112609643 (PRKCA)   09152 Endocrine system    04911 Insulin secretion     112609643 (PRKCA)    04929 GnRH secretion     112609643 (PRKCA)    04912 GnRH signaling pathway     112609643 (PRKCA)    04921 Oxytocin signaling pathway     112609643 (PRKCA)    04926 Relaxin signaling pathway     112609643 (PRKCA)    04935 Growth hormone synthesis, secretion and action     112609643 (PRKCA)    04918 Thyroid hormone synthesis     112609643 (PRKCA)    04919 Thyroid hormone signaling pathway     112609643 (PRKCA)    04928 Parathyroid hormone synthesis, secretion and action     112609643 (PRKCA)    04916 Melanogenesis     112609643 (PRKCA)    04925 Aldosterone synthesis and secretion     112609643 (PRKCA)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112609643 (PRKCA)    04270 Vascular smooth muscle contraction     112609643 (PRKCA)   09154 Digestive system    04970 Salivary secretion     112609643 (PRKCA)    04971 Gastric acid secretion     112609643 (PRKCA)    04972 Pancreatic secretion     112609643 (PRKCA)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     112609643 (PRKCA)    04961 Endocrine and other factor-regulated calcium reabsorption     112609643 (PRKCA)   09156 Nervous system    04724 Glutamatergic synapse     112609643 (PRKCA)    04727 GABAergic synapse     112609643 (PRKCA)    04725 Cholinergic synapse     112609643 (PRKCA)    04728 Dopaminergic synapse     112609643 (PRKCA)    04726 Serotonergic synapse     112609643 (PRKCA)    04720 Long-term potentiation     112609643 (PRKCA)    04730 Long-term depression     112609643 (PRKCA)    04723 Retrograde endocannabinoid signaling     112609643 (PRKCA)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     112609643 (PRKCA)   09158 Development and regeneration    04360 Axon guidance     112609643 (PRKCA)   09159 Environmental adaptation    04713 Circadian entrainment     112609643 (PRKCA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112609643 (PRKCA)    05206 MicroRNAs in cancer     112609643 (PRKCA)    05205 Proteoglycans in cancer     112609643 (PRKCA)    05207 Chemical carcinogenesis - receptor activation     112609643 (PRKCA)    05231 Choline metabolism in cancer     112609643 (PRKCA)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112609643 (PRKCA)    05214 Glioma     112609643 (PRKCA)    05223 Non-small cell lung cancer     112609643 (PRKCA)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112609643 (PRKCA)    05161 Hepatitis B     112609643 (PRKCA)    05171 Coronavirus disease - COVID-19     112609643 (PRKCA)    05164 Influenza A     112609643 (PRKCA)    05163 Human cytomegalovirus infection     112609643 (PRKCA)   09174 Infectious disease: parasitic    05146 Amoebiasis     112609643 (PRKCA)    05143 African trypanosomiasis     112609643 (PRKCA)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     112609643 (PRKCA)    05022 Pathways of neurodegeneration - multiple diseases     112609643 (PRKCA)   09165 Substance dependence    05031 Amphetamine addiction     112609643 (PRKCA)    05032 Morphine addiction     112609643 (PRKCA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112609643 (PRKCA)    05415 Diabetic cardiomyopathy     112609643 (PRKCA)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112609643 (PRKCA)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112609643 (PRKCA)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:tge01001]     112609643 (PRKCA)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112609643 (PRKCA) Enzymes [BR:tge01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      112609643 (PRKCA) Protein kinases [BR:tge01001]  Serine/threonine kinases: AGC group   PKC family [OT]    112609643 (PRKCA) Membrane trafficking [BR:tge04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     112609643 (PRKCA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 ABC1 Motif Other DBs NCBI-GeneID:  112609643 NCBI-ProteinID:  XP_025218385 Ensembl:  ENSTGEG00000025190 UniProt:  A0A8D2G8S5 LinkDB All DBs Position 16:39832779..40334433 Genome browser AA seq 672 aa AA seqDB search MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN PQFVHPILQSAV NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt gggaaacagggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtcc ctgctgtatggacttatccaccaagggatgaaatgtgacacctgcgatatgaacgttcac aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacacagagaagagaggg cggatttacctaaaggctgaggttgctgatgaaaaactccatgtcacagtacgagatgca aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactaaat ccccagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc tttggggtttcggagctaatgaagatgccagccagtggatggtacaagttgcttaaccaa gaagaaggtgagtactacaatgtacccattccagaaggggacgaagaaggaaacatggaa ctcaggcagaaattcgagaaagccaagcttggccctgctggcaacaaagtcatcagtccc tctgaagacaggaaacaaccttccaacaacctggaccgagtgaaactcaccgacttcaat ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgccgacaggaagggc acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgacgac gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca gtattctatgcggcagagatttccatcggattgttctttcttcacaaaagaggaatcatt tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg actccagattacatcgccccagagattatcgcttatcagccatatggaaaatctgtggac tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt gaagatgaggacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc ttgtccaaggaggctgtttccatctgcaaaggactgatgaccaaacacccagccaagcgg ctgggctgcgggcctgagggggagagggacgtgagagaacatgctttcttccggaggatc gactgggaaaaactggagaacagggagatccagccaccgttcaagcccaaagtgtgcggc aaaggagcagaaaactttgacaagttcttcacacgagggcagcccgtcttaacaccgcct gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac ccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system