Theropithecus gelada (gelada): 112609760 Help Entry 112609760         CDS       T08041                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway tge04621   NOD-like receptor signaling pathway tge04657   IL-17 signaling pathway tge04668   TNF signaling pathway tge04933   AGE-RAGE signaling pathway in diabetic complications tge05135   Yersinia infection tge05142   Chagas disease tge05144   Malaria tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05168   Herpes simplex virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05323   Rheumatoid arthritis tge05417   Lipid and atherosclerosis tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     112609760 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112609760 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     112609760 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112609760 (CCL2)    04657 IL-17 signaling pathway     112609760 (CCL2)    04062 Chemokine signaling pathway     112609760 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112609760 (CCL2)    05164 Influenza A     112609760 (CCL2)    05168 Herpes simplex virus 1 infection     112609760 (CCL2)    05163 Human cytomegalovirus infection     112609760 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     112609760 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     112609760 (CCL2)    05142 Chagas disease     112609760 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     112609760 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112609760 (CCL2)    05418 Fluid shear stress and atherosclerosis     112609760 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112609760 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112609760 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112609760 (CCL2) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112609760 (CCL2) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Chemokines    112609760 (CCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  112609760 NCBI-ProteinID:  XP_025218622 Ensembl:  ENSTGEG00000014781 UniProt:  A0A8D2FD90 LinkDB All DBs Position 16:8250882..8252784 Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQIQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccag gggctcgctcagccagatgcaatcaatgcccccgtcacttgctgctataacttcaccaac aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccacctggacaagcaaatccaaactccgaagccttga

DBGET integrated database retrieval system