Theropithecus gelada (gelada): 112610039 Help Entry 112610039         CDS       T08041                                  Symbol CCL1 Name (RefSeq) C-C motif chemokine 1   KO K05514   C-C motif chemokine 1 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112610039 (CCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     112610039 (CCL1)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     112610039 (CCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112610039 (CCL1) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112610039 (CCL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 SelP_C Kazal_CFAI Motif Other DBs NCBI-GeneID:  112610039 NCBI-ProteinID:  XP_025219093 Ensembl:  ENSTGEG00000014914 UniProt:  A0A8D2FBR6 LinkDB All DBs Position 16:complement(8356790..8359634) Genome browser AA seq 96 aa AA seqDB search MQIITTALVCLLLAGMWPQDVDSKSMQVPFSRCCFLFVEKEISLRAIQCYRNTSSSCSNE GLIFKLKRGNEACALNKARWVQNHIKKLSHCLPKRK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcagatcatcaccacagccctggtgtgcttgctgctagctgggatgtggccacaagac gtggacagcaagagcatgcaggtacccttctccagatgttgcttcttatttgtggagaaa gagatttccctgcgggcaatccagtgttacagaaataccagctccagctgctccaatgag ggcttaatattcaagctgaagagaggcaacgaggcctgcgccttgaacaaggctagatgg gttcagaatcacattaaaaagctgagccactgcctgccaaaaagaaaatga

DBGET integrated database retrieval system