Theropithecus gelada (gelada): 112612423 Help Entry 112612423         CDS       T08041                                  Symbol CALM3 Name (RefSeq) calmodulin-3 isoform X1   KO K02183   calmodulin Organism tge  Theropithecus gelada (gelada) Pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04020   Calcium signaling pathway tge04022   cGMP-PKG signaling pathway tge04024   cAMP signaling pathway tge04070   Phosphatidylinositol signaling system tge04114   Oocyte meiosis tge04218   Cellular senescence tge04261   Adrenergic signaling in cardiomyocytes tge04270   Vascular smooth muscle contraction tge04371   Apelin signaling pathway tge04625   C-type lectin receptor signaling pathway tge04713   Circadian entrainment tge04720   Long-term potentiation tge04722   Neurotrophin signaling pathway tge04728   Dopaminergic synapse tge04740   Olfactory transduction tge04744   Phototransduction tge04750   Inflammatory mediator regulation of TRP channels tge04910   Insulin signaling pathway tge04912   GnRH signaling pathway tge04915   Estrogen signaling pathway tge04916   Melanogenesis tge04921   Oxytocin signaling pathway tge04922   Glucagon signaling pathway tge04924   Renin secretion tge04925   Aldosterone synthesis and secretion tge04970   Salivary secretion tge04971   Gastric acid secretion tge05010   Alzheimer disease tge05012   Parkinson disease tge05022   Pathways of neurodegeneration - multiple diseases tge05031   Amphetamine addiction tge05034   Alcoholism tge05133   Pertussis tge05152   Tuberculosis tge05163   Human cytomegalovirus infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05170   Human immunodeficiency virus 1 infection tge05200   Pathways in cancer tge05214   Glioma tge05417   Lipid and atherosclerosis tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112612423 (CALM3)    04015 Rap1 signaling pathway     112612423 (CALM3)    04371 Apelin signaling pathway     112612423 (CALM3)    04020 Calcium signaling pathway     112612423 (CALM3)    04070 Phosphatidylinositol signaling system     112612423 (CALM3)    04024 cAMP signaling pathway     112612423 (CALM3)    04022 cGMP-PKG signaling pathway     112612423 (CALM3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112612423 (CALM3)    04218 Cellular senescence     112612423 (CALM3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112612423 (CALM3)   09152 Endocrine system    04910 Insulin signaling pathway     112612423 (CALM3)    04922 Glucagon signaling pathway     112612423 (CALM3)    04912 GnRH signaling pathway     112612423 (CALM3)    04915 Estrogen signaling pathway     112612423 (CALM3)    04921 Oxytocin signaling pathway     112612423 (CALM3)    04916 Melanogenesis     112612423 (CALM3)    04924 Renin secretion     112612423 (CALM3)    04925 Aldosterone synthesis and secretion     112612423 (CALM3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112612423 (CALM3)    04270 Vascular smooth muscle contraction     112612423 (CALM3)   09154 Digestive system    04970 Salivary secretion     112612423 (CALM3)    04971 Gastric acid secretion     112612423 (CALM3)   09156 Nervous system    04728 Dopaminergic synapse     112612423 (CALM3)    04720 Long-term potentiation     112612423 (CALM3)    04722 Neurotrophin signaling pathway     112612423 (CALM3)   09157 Sensory system    04744 Phototransduction     112612423 (CALM3)    04740 Olfactory transduction     112612423 (CALM3)    04750 Inflammatory mediator regulation of TRP channels     112612423 (CALM3)   09159 Environmental adaptation    04713 Circadian entrainment     112612423 (CALM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112612423 (CALM3)   09162 Cancer: specific types    05214 Glioma     112612423 (CALM3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112612423 (CALM3)    05163 Human cytomegalovirus infection     112612423 (CALM3)    05167 Kaposi sarcoma-associated herpesvirus infection     112612423 (CALM3)   09171 Infectious disease: bacterial    05133 Pertussis     112612423 (CALM3)    05152 Tuberculosis     112612423 (CALM3)   09164 Neurodegenerative disease    05010 Alzheimer disease     112612423 (CALM3)    05012 Parkinson disease     112612423 (CALM3)    05022 Pathways of neurodegeneration - multiple diseases     112612423 (CALM3)   09165 Substance dependence    05031 Amphetamine addiction     112612423 (CALM3)    05034 Alcoholism     112612423 (CALM3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112612423 (CALM3)    05418 Fluid shear stress and atherosclerosis     112612423 (CALM3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tge01009]     112612423 (CALM3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112612423 (CALM3)    03036 Chromosome and associated proteins [BR:tge03036]     112612423 (CALM3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112612423 (CALM3) Protein phosphatases and associated proteins [BR:tge01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112612423 (CALM3) Membrane trafficking [BR:tge04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112612423 (CALM3) Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112612423 (CALM3) Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112612423 (CALM3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EH UPF0154 EF_EFCAB10_C Dockerin_1 EF-hand_11 SPARC_Ca_bdg PhageMin_Tail Motif Other DBs NCBI-GeneID:  112612423 NCBI-ProteinID:  XP_025222708 Ensembl:  ENSTGEG00000022795 LinkDB All DBs Position 19:23759729..23769443 Genome browser AA seq 234 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKVSNPPGAALRLTPAFRQTDRTGSTE LPLPGGPRPGASLTANLLCHLRQPPSLCSLPRDGDDSHPSHCLSPRREKCPVKAFIPNPQ DGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagctgactgaggagcagatcgcagagttcaaggaggccttctccctcttt gacaaggatggagatggcactatcaccaccaaggagttggggacagtgatgagatccctg ggacagaaccccactgaagcagagctgcaggatatgatcaatgaggtggatgcagatggg aacgggaccattgacttcccggagttcctgaccatgatggccagaaagatgaaggacaca gacagtgaggaggagatccgagaggcgttccgtgtctttgacaaggtaagcaaccctcca ggggcggctctgagactgacaccagccttcaggcagacagacagaactggatccacggag ctaccacttccaggaggcccacgtcccggtgccagcctcactgccaacctgctctgccac ctcaggcagcctccctcactgtgctcactgccgagggatggtgatgacagccacccctct cactgcctctctccccgccgggagaagtgcccagtgaaagcctttatccccaacccccag gatgggaacggctacatcagcgccgcagagctgcgtcacgtaatgacgaacctgggggag aagctgaccgatgaggaggtggatgagatgatcagagaggctgacatcgacggagatggc caggtcaattatgaagagtttgtacagatgatgactgcaaagtga

DBGET integrated database retrieval system