Theropithecus gelada (gelada): 112613465
Help
Entry
112613465 CDS
T08041
Symbol
PSENEN
Name
(RefSeq) gamma-secretase subunit PEN-2
KO
K06170
presenilin enhancer 2
Organism
tge
Theropithecus gelada (gelada)
Pathway
tge04330
Notch signaling pathway
tge05010
Alzheimer disease
Brite
KEGG Orthology (KO) [BR:
tge00001
]
09130 Environmental Information Processing
09132 Signal transduction
04330 Notch signaling pathway
112613465 (PSENEN)
09160 Human Diseases
09164 Neurodegenerative disease
05010 Alzheimer disease
112613465 (PSENEN)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PEN-2
Motif
Other DBs
NCBI-GeneID:
112613465
NCBI-ProteinID:
XP_025224779
Ensembl:
ENSTGEG00000009468
LinkDB
All DBs
Position
19:complement(44136963..44139798)
Genome browser
AA seq
101 aa
AA seq
DB search
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS
AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq
306 nt
NT seq
+upstream
nt +downstream
nt
atgaacctggagcgagtgtccaatgaggagaagttgaacctgtgccggaagtactacctg
ggtgggtttgctttcctgccttttctctggttggtcaacatcttctggttcttccgagag
gccttccttgtcccagcctacacagaacagagccaaatcaaaggctatgtctggcgctca
gctgtgggcttcctcttctgggtgatagtgctcacctcctggatcaccatcttccagatc
taccggccccgctggggtgcccttggggactacctctccttcaccatacctctgggcacc
ccctga
DBGET
integrated database retrieval system