Theropithecus gelada (gelada): 112613542 Help Entry 112613542         CDS       T08041                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism tge  Theropithecus gelada (gelada) Pathway tge04010   MAPK signaling pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04020   Calcium signaling pathway tge04151   PI3K-Akt signaling pathway tge04714   Thermogenesis tge04810   Regulation of actin cytoskeleton tge05200   Pathways in cancer tge05218   Melanoma tge05224   Breast cancer tge05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112613542 (FGF21)    04014 Ras signaling pathway     112613542 (FGF21)    04015 Rap1 signaling pathway     112613542 (FGF21)    04020 Calcium signaling pathway     112613542 (FGF21)    04151 PI3K-Akt signaling pathway     112613542 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112613542 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     112613542 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112613542 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     112613542 (FGF21)    05218 Melanoma     112613542 (FGF21)    05224 Breast cancer     112613542 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112613542 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112613542 (FGF21) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Growth factors (RTK binding)    112613542 (FGF21) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Growth factors/receptors    112613542 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Lysis_col Motif Other DBs NCBI-GeneID:  112613542 NCBI-ProteinID:  XP_025224939 Ensembl:  ENSTGEG00000025318 UniProt:  A0A8D2G9I9 LinkDB All DBs Position 19:25910791..25913446 Genome browser AA seq 209 aa AA seqDB search MDSDETGFEHSGLWVPVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH LEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEA CSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPAFRGPARFLPLPGLPPAPPEPPGI LAPQPPDVGSSDPLSMVGPSQARSPSYAS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggactcggacgagaccgggttcgagcactcaggactgtgggttcctgtgctggctggt cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc gggggccaagtccggcaacggtacctctacacagacgatgcccagcagacagaagcccac ctggagatcagggaggatgggacagtggggggcgctgctcaccagagccccgaaagtctc ctgcagctgaaagccttgaagccaggagttattcaaatcttgggagtcaagacatccaga ttcctgtgccagaagccagatggggccctgtatggatcgctccactttgaccctgaggcc tgcagcttccgggagctgcttcttgagaacggatacaatgtttaccagtccgaggcccac ggcctcccactgcacctgccgggaaacaagtccccacaccgggaccctgcattccgagga ccagctcgcttcctgccactaccaggcctgccccccgcacccccagagccgccaggaatc ctcgccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc caggcccgaagccctagctacgcttcctga

DBGET integrated database retrieval system