Theropithecus gelada (gelada): 112614039
Help
Entry
112614039 CDS
T08041
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
tge
Theropithecus gelada (gelada)
Pathway
tge03050
Proteasome
tge05010
Alzheimer disease
tge05012
Parkinson disease
tge05014
Amyotrophic lateral sclerosis
tge05016
Huntington disease
tge05017
Spinocerebellar ataxia
tge05020
Prion disease
tge05022
Pathways of neurodegeneration - multiple diseases
tge05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
tge00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
112614039 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
112614039 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
112614039 (PSMD7)
05012 Parkinson disease
112614039 (PSMD7)
05014 Amyotrophic lateral sclerosis
112614039 (PSMD7)
05016 Huntington disease
112614039 (PSMD7)
05017 Spinocerebellar ataxia
112614039 (PSMD7)
05020 Prion disease
112614039 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
112614039 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
tge03051
]
112614039 (PSMD7)
Proteasome [BR:
tge03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
112614039 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
112614039
NCBI-ProteinID:
XP_025225921
Ensembl:
ENSTGEG00000010108
UniProt:
A0A8D2JZ86
LinkDB
All DBs
Position
20:complement(27837268..27846939)
Genome browser
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KEDKEKDKDKEKSDVKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgttgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaatcagaagcgcgttgttggtgtgcttttg
ggctcatggcaaaagaaagtacttgatgtatcgaacagttttgcagttccttttgacgaa
gatgacaaagacgattctgtgtggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagagaaagaatagttggctggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattccgta
ctggttatcattgatgtgaagccgaaggacctagggctgcccacagaagcgtacatttca
gtggaagaagtccatgatgatggaaccccaacctcaaaaacatttgaacacgtgaccagt
gaaattggagcagaggaagctgaggaagttggagttgaacacttgttacgagacatcaaa
gacacgacggtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggaaaaagtcgccacaggcaagcta
cctatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagacgtc
agcctgcaggagtttgtcaaggccttttacctgaagaccaacgaccagatggtggtagtg
tacttggcctcactgatccgttccgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgcgatgcagagaagaaagaagggcaggagaaagaagacagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatgtaaagaaagaggagaaa
aaggagaaaaagtaa
DBGET
integrated database retrieval system