Theropithecus gelada (gelada): 112614384 Help Entry 112614384         CDS       T08041                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway tge04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112614384 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     112614384 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112614384 (CCL22)    04062 Chemokine signaling pathway     112614384 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112614384 (CCL22) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112614384 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112614384 NCBI-ProteinID:  XP_025226662 Ensembl:  ENSTGEG00000000133 UniProt:  A0A8D2DY59 LinkDB All DBs Position 20:15285841..15293901 Genome browser AA seq 93 aa AA seqDB search MARLQTVFLGVLILLAVALQATEAGPYGANMEDSVCCRDYVRYRMPLRVVKHFYWTSDSC PRPGVVLLTSRDKEICADPRVPWVKMILNKLSQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctcgcctacagactgtgttcctgggtgtcctcatcctccttgctgtggcgcttcaa gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac gtccgttaccgtatgcccctgcgtgtggtgaaacacttctactggacctcagactcctgc ccgaggcctggcgtggtgttgctaacctccagggataaggagatctgtgccgatcccaga gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system