Theropithecus gelada (gelada): 112614628 Help Entry 112614628         CDS       T08041                                  Name (RefSeq) metallothionein-1E isoform X1   KO K14739   metallothionein 1/2 Organism tge  Theropithecus gelada (gelada) Pathway tge04978   Mineral absorption Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     112614628  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tge03019]     112614628    03029 Mitochondrial biogenesis [BR:tge03029]     112614628 Messenger RNA biogenesis [BR:tge03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      112614628 Mitochondrial biogenesis [BR:tge03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     112614628 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  112614628 NCBI-ProteinID:  XP_025227121 Ensembl:  ENSTGEG00000024611 UniProt:  A0A8D2FZA5 LinkDB All DBs Position 20:14535370..14537079 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtgtctcctgcacctgcgctggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggcgtcggagaagtgcagctgctgt gcctga

DBGET integrated database retrieval system