Theropithecus gelada (gelada): 112616411 Help Entry 112616411         CDS       T08041                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism tge  Theropithecus gelada (gelada) Pathway tge04010   MAPK signaling pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04020   Calcium signaling pathway tge04151   PI3K-Akt signaling pathway tge04810   Regulation of actin cytoskeleton tge05200   Pathways in cancer tge05207   Chemical carcinogenesis - receptor activation tge05218   Melanoma tge05224   Breast cancer tge05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112616411 (FGF16)    04014 Ras signaling pathway     112616411 (FGF16)    04015 Rap1 signaling pathway     112616411 (FGF16)    04020 Calcium signaling pathway     112616411 (FGF16)    04151 PI3K-Akt signaling pathway     112616411 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112616411 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112616411 (FGF16)    05207 Chemical carcinogenesis - receptor activation     112616411 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     112616411 (FGF16)    05218 Melanoma     112616411 (FGF16)    05224 Breast cancer     112616411 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112616411 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112616411 (FGF16) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Growth factors (RTK binding)    112616411 (FGF16) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Growth factors/receptors    112616411 (FGF16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  112616411 NCBI-ProteinID:  XP_025229158 Ensembl:  ENSTGEG00000001694 UniProt:  A0A8D2E6W2 LinkDB All DBs Position X:complement(76878821..76887740) Genome browser AA seq 207 aa AA seqDB search MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH QKFTHFLPRPVDPSKLPSMSRDLFHYR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctcg tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg cggcgccgccagctctactgccgcactggcttccacctggagatcttccccaacggcacg gtgcacggcacccgccacgaccacagccgcttcggtatcctggagtttattagcctggct gtggggctgatcagcatccggggagtggactctggtctgtacctaggaatgaacgagcga ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa gaaaactggtacaacacctatgcctcaaccttgtacaaacattcggactcggagagacag tattacgtagccctgaataaagacggctcaccccgggagggatacaggactaaacgacac cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc agagacctctttcactataggtaa

DBGET integrated database retrieval system