Theropithecus gelada (gelada): 112617105 Help Entry 112617105         CDS       T08041                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism tge  Theropithecus gelada (gelada) Pathway tge04613   Neutrophil extracellular trap formation tge05034   Alcoholism tge05202   Transcriptional misregulation in cancer tge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112617105  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112617105   09163 Immune disease    05322 Systemic lupus erythematosus     112617105   09165 Substance dependence    05034 Alcoholism     112617105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tge03036]     112617105   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112617105 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112617105 Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112617105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  112617105 NCBI-ProteinID:  XP_025229605 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARCIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcaccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaagcttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggtctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgctgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system