Theropithecus gelada (gelada): 112617897 Help Entry 112617897         CDS       T08041                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway tge04620   Toll-like receptor signaling pathway tge05142   Chagas disease tge05163   Human cytomegalovirus infection tge05323   Rheumatoid arthritis tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112617897    04061 Viral protein interaction with cytokine and cytokine receptor     112617897  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112617897    04062 Chemokine signaling pathway     112617897  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112617897   09174 Infectious disease: parasitic    05142 Chagas disease     112617897   09163 Immune disease    05323 Rheumatoid arthritis     112617897   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112617897  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112617897    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112617897 Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112617897 Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Chemokines    112617897 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112617897 NCBI-ProteinID:  XP_025230325 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MQVSTAALAVLLCTVALCNQISATFAADTPTSCCFSYISRHIPQNFIVDYFETSSQCSKP GV NT seq 188 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctccactgctgcccttgctgtcctcctctgcaccgtggctctctgcaaccag atctcggcaacatttgctgctgacaccccgacctcctgctgcttcagctacatctcccgg cacattccacagaatttcatagttgactactttgagaccagcagccagtgctccaagccc ggtgtcat

DBGET integrated database retrieval system