Theropithecus gelada (gelada): 112618983 Help Entry 112618983         CDS       T08041                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism tge  Theropithecus gelada (gelada) Pathway tge04015   Rap1 signaling pathway tge04810   Regulation of actin cytoskeleton tge05014   Amyotrophic lateral sclerosis tge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112618983 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112618983 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112618983 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112618983 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112618983 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tge04812]     112618983 (PFN2)    04147 Exosome [BR:tge04147]     112618983 (PFN2) Membrane trafficking [BR:tge04131]  Others   Actin-binding proteins    Others     112618983 (PFN2) Cytoskeleton proteins [BR:tge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112618983 (PFN2) Exosome [BR:tge04147]  Exosomal proteins   Proteins found in most exosomes    112618983 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112618983 NCBI-ProteinID:  XP_025232475 Ensembl:  ENSTGEG00000006636 LinkDB All DBs Position 2:142278267..142284702 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system