Theropithecus gelada (gelada): 112619083 Help Entry 112619083         CDS       T08041                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism tge  Theropithecus gelada (gelada) Pathway tge04014   Ras signaling pathway tge04137   Mitophagy - animal tge04144   Endocytosis tge04145   Phagosome tge04148   Efferocytosis tge04962   Vasopressin-regulated water reabsorption tge05014   Amyotrophic lateral sclerosis tge05022   Pathways of neurodegeneration - multiple diseases tge05132   Salmonella infection tge05146   Amoebiasis tge05152   Tuberculosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112619083 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112619083 (RAB5A)    04145 Phagosome     112619083 (RAB5A)    04137 Mitophagy - animal     112619083 (RAB5A)    04148 Efferocytosis     112619083 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     112619083 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112619083 (RAB5A)    05152 Tuberculosis     112619083 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     112619083 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112619083 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     112619083 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112619083 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112619083 (RAB5A)    04031 GTP-binding proteins [BR:tge04031]     112619083 (RAB5A) Membrane trafficking [BR:tge04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     112619083 (RAB5A)  Endosome - Lysosome transport     112619083 (RAB5A) Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112619083 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    112619083 (RAB5A)   Exosomal proteins of colorectal cancer cells    112619083 (RAB5A)   Exosomal proteins of bladder cancer cells    112619083 (RAB5A) GTP-binding proteins [BR:tge04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     112619083 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  112619083 NCBI-ProteinID:  XP_025232699 Ensembl:  ENSTGEG00000018059 UniProt:  A0A8D2FK03 LinkDB All DBs Position 2:166485243..166521393 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcgccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac ctcaccgaacccacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system