Theropithecus gelada (gelada): 112619416 Help Entry 112619416         CDS       T08041                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism tge  Theropithecus gelada (gelada) Pathway tge01521   EGFR tyrosine kinase inhibitor resistance tge01522   Endocrine resistance tge04010   MAPK signaling pathway tge04012   ErbB signaling pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04062   Chemokine signaling pathway tge04068   FoxO signaling pathway tge04071   Sphingolipid signaling pathway tge04072   Phospholipase D signaling pathway tge04137   Mitophagy - animal tge04140   Autophagy - animal tge04150   mTOR signaling pathway tge04151   PI3K-Akt signaling pathway tge04210   Apoptosis tge04211   Longevity regulating pathway tge04213   Longevity regulating pathway - multiple species tge04218   Cellular senescence tge04360   Axon guidance tge04370   VEGF signaling pathway tge04371   Apelin signaling pathway tge04540   Gap junction tge04550   Signaling pathways regulating pluripotency of stem cells tge04625   C-type lectin receptor signaling pathway tge04650   Natural killer cell mediated cytotoxicity tge04660   T cell receptor signaling pathway tge04662   B cell receptor signaling pathway tge04664   Fc epsilon RI signaling pathway tge04714   Thermogenesis tge04720   Long-term potentiation tge04722   Neurotrophin signaling pathway tge04725   Cholinergic synapse tge04726   Serotonergic synapse tge04730   Long-term depression tge04810   Regulation of actin cytoskeleton tge04910   Insulin signaling pathway tge04912   GnRH signaling pathway tge04915   Estrogen signaling pathway tge04916   Melanogenesis tge04917   Prolactin signaling pathway tge04919   Thyroid hormone signaling pathway tge04921   Oxytocin signaling pathway tge04926   Relaxin signaling pathway tge04929   GnRH secretion tge04933   AGE-RAGE signaling pathway in diabetic complications tge04935   Growth hormone synthesis, secretion and action tge05010   Alzheimer disease tge05022   Pathways of neurodegeneration - multiple diseases tge05034   Alcoholism tge05160   Hepatitis C tge05161   Hepatitis B tge05163   Human cytomegalovirus infection tge05165   Human papillomavirus infection tge05166   Human T-cell leukemia virus 1 infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05170   Human immunodeficiency virus 1 infection tge05200   Pathways in cancer tge05203   Viral carcinogenesis tge05205   Proteoglycans in cancer tge05206   MicroRNAs in cancer tge05207   Chemical carcinogenesis - receptor activation tge05208   Chemical carcinogenesis - reactive oxygen species tge05210   Colorectal cancer tge05211   Renal cell carcinoma tge05213   Endometrial cancer tge05214   Glioma tge05215   Prostate cancer tge05216   Thyroid cancer tge05218   Melanoma tge05219   Bladder cancer tge05220   Chronic myeloid leukemia tge05221   Acute myeloid leukemia tge05223   Non-small cell lung cancer tge05224   Breast cancer tge05225   Hepatocellular carcinoma tge05226   Gastric cancer tge05230   Central carbon metabolism in cancer tge05231   Choline metabolism in cancer tge05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112619416 (NRAS)    04012 ErbB signaling pathway     112619416 (NRAS)    04014 Ras signaling pathway     112619416 (NRAS)    04015 Rap1 signaling pathway     112619416 (NRAS)    04370 VEGF signaling pathway     112619416 (NRAS)    04371 Apelin signaling pathway     112619416 (NRAS)    04068 FoxO signaling pathway     112619416 (NRAS)    04072 Phospholipase D signaling pathway     112619416 (NRAS)    04071 Sphingolipid signaling pathway     112619416 (NRAS)    04151 PI3K-Akt signaling pathway     112619416 (NRAS)    04150 mTOR signaling pathway     112619416 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112619416 (NRAS)    04137 Mitophagy - animal     112619416 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112619416 (NRAS)    04218 Cellular senescence     112619416 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112619416 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     112619416 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112619416 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112619416 (NRAS)    04650 Natural killer cell mediated cytotoxicity     112619416 (NRAS)    04660 T cell receptor signaling pathway     112619416 (NRAS)    04662 B cell receptor signaling pathway     112619416 (NRAS)    04664 Fc epsilon RI signaling pathway     112619416 (NRAS)    04062 Chemokine signaling pathway     112619416 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112619416 (NRAS)    04929 GnRH secretion     112619416 (NRAS)    04912 GnRH signaling pathway     112619416 (NRAS)    04915 Estrogen signaling pathway     112619416 (NRAS)    04917 Prolactin signaling pathway     112619416 (NRAS)    04921 Oxytocin signaling pathway     112619416 (NRAS)    04926 Relaxin signaling pathway     112619416 (NRAS)    04935 Growth hormone synthesis, secretion and action     112619416 (NRAS)    04919 Thyroid hormone signaling pathway     112619416 (NRAS)    04916 Melanogenesis     112619416 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     112619416 (NRAS)    04726 Serotonergic synapse     112619416 (NRAS)    04720 Long-term potentiation     112619416 (NRAS)    04730 Long-term depression     112619416 (NRAS)    04722 Neurotrophin signaling pathway     112619416 (NRAS)   09158 Development and regeneration    04360 Axon guidance     112619416 (NRAS)   09149 Aging    04211 Longevity regulating pathway     112619416 (NRAS)    04213 Longevity regulating pathway - multiple species     112619416 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     112619416 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112619416 (NRAS)    05206 MicroRNAs in cancer     112619416 (NRAS)    05205 Proteoglycans in cancer     112619416 (NRAS)    05207 Chemical carcinogenesis - receptor activation     112619416 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     112619416 (NRAS)    05203 Viral carcinogenesis     112619416 (NRAS)    05230 Central carbon metabolism in cancer     112619416 (NRAS)    05231 Choline metabolism in cancer     112619416 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112619416 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     112619416 (NRAS)    05225 Hepatocellular carcinoma     112619416 (NRAS)    05226 Gastric cancer     112619416 (NRAS)    05214 Glioma     112619416 (NRAS)    05216 Thyroid cancer     112619416 (NRAS)    05221 Acute myeloid leukemia     112619416 (NRAS)    05220 Chronic myeloid leukemia     112619416 (NRAS)    05218 Melanoma     112619416 (NRAS)    05211 Renal cell carcinoma     112619416 (NRAS)    05219 Bladder cancer     112619416 (NRAS)    05215 Prostate cancer     112619416 (NRAS)    05213 Endometrial cancer     112619416 (NRAS)    05224 Breast cancer     112619416 (NRAS)    05223 Non-small cell lung cancer     112619416 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112619416 (NRAS)    05170 Human immunodeficiency virus 1 infection     112619416 (NRAS)    05161 Hepatitis B     112619416 (NRAS)    05160 Hepatitis C     112619416 (NRAS)    05163 Human cytomegalovirus infection     112619416 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     112619416 (NRAS)    05165 Human papillomavirus infection     112619416 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     112619416 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     112619416 (NRAS)   09165 Substance dependence    05034 Alcoholism     112619416 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112619416 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112619416 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112619416 (NRAS)    01522 Endocrine resistance     112619416 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112619416 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112619416 (NRAS)    04031 GTP-binding proteins [BR:tge04031]     112619416 (NRAS) Membrane trafficking [BR:tge04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112619416 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112619416 (NRAS) Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112619416 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112619416 (NRAS)   Exosomal proteins of breast cancer cells    112619416 (NRAS)   Exosomal proteins of colorectal cancer cells    112619416 (NRAS) GTP-binding proteins [BR:tge04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112619416 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ATPase_2 Hpr_kinase_C Ldh_1_N Motif Other DBs NCBI-GeneID:  112619416 NCBI-ProteinID:  XP_025233173 Ensembl:  ENSTGEG00000006042 LinkDB All DBs Position 1:complement(6934266..6947334) Genome browser AA seq 222 aa AA seqDB search MAVPGSPTIFPAVVLNLSKAEAVELEVSSCWCEMTEYKLVVVGAGGVGKSALTIQLIQNH FVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNS KSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAK TRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcggttccggggtctccaacaattttccctgctgtggtcctgaatctgtccaaagca gaggcagtggagcttgaggtaagttcttgctggtgtgaaatgactgagtacaaactggtg gtggttggagcaggtggtgttgggaaaagtgcactgacaatccagctaatccagaaccac tttgtagatgaatatgatcccaccatagaggattcttacagaaaacaggtggttatagat ggtgaaacctgtttgttggacatactggatacagctggacaagaagagtacagtgccatg agagaccaatacatgaggacaggcgaaggcttcctctgtgtatttgccatcaataatagc aagtcatttgcggatattaacctctacagggagcagattaagcgagtaaaagactcggat gatgtacctatggtgctagtgggaaacaagtgtgatttgccaacaaggacagttgataca aaacaagcccacgaactggccaagagttacgggattccattcattgaaacctcagccaag accagacagggtgttgaagatgctttttacacactggtaagagaaatacgccagtaccga atgaaaaaactcaacagcagtgatgatgggactcagggttgtatgggattaccatgtgtg gtgatgtaa

DBGET integrated database retrieval system