Theropithecus gelada (gelada): 112619417 Help Entry 112619417         CDS       T08041                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tge  Theropithecus gelada (gelada) Pathway tge03010   Ribosome tge04120   Ubiquitin mediated proteolysis tge04137   Mitophagy - animal tge04140   Autophagy - animal tge05012   Parkinson disease tge05022   Pathways of neurodegeneration - multiple diseases tge05167   Kaposi sarcoma-associated herpesvirus infection tge05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:tge00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     112619417   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112619417  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112619417    04137 Mitophagy - animal     112619417  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112619417    05167 Kaposi sarcoma-associated herpesvirus infection     112619417   09164 Neurodegenerative disease    05012 Parkinson disease     112619417    05022 Pathways of neurodegeneration - multiple diseases     112619417  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tge03011]     112619417    04121 Ubiquitin system [BR:tge04121]     112619417 Ribosome [BR:tge03011]  Ribosomal proteins   Eukaryotes    Large subunit     112619417   Archaea     112619417 Ubiquitin system [BR:tge04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    112619417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Ubiquitin_5 DUF3104 Motif Other DBs NCBI-GeneID:  112619417 NCBI-ProteinID:  XP_025233171 Ensembl:  ENSTGEG00000020279 UniProt:  A0A8D2FMT5 LinkDB All DBs Position 2:174024725..174025177 Genome browser AA seq 139 aa AA seqDB search MQIFVKTLTGKTITLEVKPSDTNEDVKAKIQDKEGIPPDQQHLILAGKQVEDGRTLSDYD IWEESTLHLVLRLRGGIIEPSLRQLFQKRNFDKMICRKCYACLHPHAVNCCKKCDHTNNL HPKKKVKALPRRAASLEPQ NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagacacttacgggcaagaccatcactcttgaggtcaagcccagt gacaccaatgaggatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag cagcatctgatacttgccggcaaacaggtggaggatggccgaactctctcagactacgac atttgggaagagtccaccctgcacctggtgctgcgcctgcgaggtggcattattgagcct tccctccgccagctcttccagaaacgcaactttgacaagatgatctgccgcaagtgctat gcttgcctgcacccccatgctgtcaactgctgcaagaagtgtgaccacaccaacaacctg caccccaagaagaaggtcaaggctcttcctcgaagggcagcctccctggagcctcaataa

DBGET integrated database retrieval system