Theropithecus gelada (gelada): 112620291 Help Entry 112620291         CDS       T08041                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism tge  Theropithecus gelada (gelada) Pathway tge04072   Phospholipase D signaling pathway tge04140   Autophagy - animal tge04150   mTOR signaling pathway tge04151   PI3K-Akt signaling pathway tge04152   AMPK signaling pathway tge04211   Longevity regulating pathway tge04218   Cellular senescence tge04714   Thermogenesis tge04910   Insulin signaling pathway tge04919   Thyroid hormone signaling pathway tge05163   Human cytomegalovirus infection tge05165   Human papillomavirus infection tge05168   Herpes simplex virus 1 infection tge05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     112620291 (RHEB)    04151 PI3K-Akt signaling pathway     112620291 (RHEB)    04152 AMPK signaling pathway     112620291 (RHEB)    04150 mTOR signaling pathway     112620291 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112620291 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     112620291 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112620291 (RHEB)    04919 Thyroid hormone signaling pathway     112620291 (RHEB)   09149 Aging    04211 Longevity regulating pathway     112620291 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     112620291 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     112620291 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     112620291 (RHEB)    05163 Human cytomegalovirus infection     112620291 (RHEB)    05165 Human papillomavirus infection     112620291 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tge04031]     112620291 (RHEB) GTP-binding proteins [BR:tge04031]  Small (monomeric) G-proteins   Ras Family    Rheb     112620291 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  112620291 NCBI-ProteinID:  XP_025234430 Ensembl:  ENSTGEG00000005482 UniProt:  A0A8D2EKQ1 LinkDB All DBs Position 3:complement(175521058..175573668) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattctatctttcctcagacctactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatggatggggcagcttcacaaggcaagtcttca tgctcggtgatgtga

DBGET integrated database retrieval system