Theropithecus gelada (gelada): 112623108 Help Entry 112623108         CDS       T08041                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism tge  Theropithecus gelada (gelada) Pathway tge04613   Neutrophil extracellular trap formation tge05034   Alcoholism tge05202   Transcriptional misregulation in cancer tge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112623108  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112623108   09163 Immune disease    05322 Systemic lupus erythematosus     112623108   09165 Substance dependence    05034 Alcoholism     112623108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tge03036]     112623108   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112623108 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112623108 Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112623108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  112623108 NCBI-ProteinID:  XP_025239095 Ensembl:  ENSTGEG00000002937 LinkDB All DBs Position 4:complement(30653476..30655472) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtacgaagcagactgctcgcaagtccaccggcggcaaggctccgcgcaagcag ctggctacgaaggcggctcggaagagcgctccggccaccggcggcgtcaagaagccccat cgctaccggcctggtacagtggctctccgcgagatccgccgctaccagaagtccaccgag ctgctgatcagaaagttgccttttcagcgtctggtgcgagagatcgcgcaggactttaag accgacctgcgctttcagagctcggcggtgatggcgctgcaagaggcatgcgaggcctac ctggtggggctctttgaggacaccaacctgtgcgccatccacgccaagagggtgactatc atgcccaaggatatccagctcgcacgtcgtatccgcggcgagagggcttga

DBGET integrated database retrieval system