Theropithecus gelada (gelada): 112623174 Help Entry 112623174         CDS       T08041                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04064   NF-kappa B signaling pathway tge04668   TNF signaling pathway tge04940   Type I diabetes mellitus tge05166   Human T-cell leukemia virus 1 infection tge05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112623174 (LTA)    04668 TNF signaling pathway     112623174 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112623174 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     112623174 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112623174 (LTA)    05168 Herpes simplex virus 1 infection     112623174 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112623174 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112623174 (LTA) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Tumor necrosis fators    112623174 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  112623174 NCBI-ProteinID:  XP_025239196 Ensembl:  ENSTGEG00000029373 UniProt:  A0A8D2GIS4 LinkDB All DBs Position 4:34034487..34036508 Genome browser AA seq 205 aa AA seqDB search MTPPERLFLSRVRGSPLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATPTPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctgaacgtctcttcctctcaagggtgcgtggcagccccctacacctcctc ctcctggggctgctgctggtcctgctgcctggggcccaggggctccctggtgttggcctc acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga gcgaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac tctcctaaggccacccccaccccactctacctggcccatgaggtccagctcttctcctcc cagtaccccttccacgtgcctcttctcagctcccagaagatggtgtatccagggctgcag gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt ggagccttcgctctgtag

DBGET integrated database retrieval system