Theropithecus gelada (gelada): 112624313 Help Entry 112624313         CDS       T08041                                  Name (RefSeq) C-X-C motif chemokine 5-like   KO K05506   C-X-C motif chemokine 5/6 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway tge04657   IL-17 signaling pathway tge04668   TNF signaling pathway tge05133   Pertussis tge05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     112624313   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112624313    04061 Viral protein interaction with cytokine and cytokine receptor     112624313  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     112624313    04062 Chemokine signaling pathway     112624313  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     112624313   09163 Immune disease    05323 Rheumatoid arthritis     112624313  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112624313 Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112624313 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112624313 NCBI-ProteinID:  XP_025240604 Ensembl:  ENSTGEG00000014501 LinkDB All DBs Position 5:68095572..68096150 Genome browser AA seq 113 aa AA seqDB search MSLLSNRPARVPGPSGFLCALLALLLLLTPPGPLSPAGPVAAALRELRCSCLQTTQGVQP QMISNLQVFAIGPQCSEVEVVASLKNGTEVCLDPQAPFLKKVIQKILDGYLSL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagcctcctgtccaatcgcccggcccgtgtcccgggtccttcgggcttcttgtgcgcg ctgctcgcgctgctgctgctgctgacgccgccagggcccctcagcccagctggtcctgtc gctgctgcgttgagagagctgcgttgcagttgtttacagaccacgcagggagttcaaccc caaatgatcagtaatctgcaggtgttcgccataggcccccagtgctccgaggtggaagtg gtagcctccctgaagaacgggactgaagtttgtctggatccacaagccccttttctaaag aaagtcatccagaaaattttggacgggtacttatcactttga

DBGET integrated database retrieval system