Theropithecus gelada (gelada): 112625331 Help Entry 112625331         CDS       T08041                                  Name (RefSeq) platelet factor 4 variant   KO K05407   platelet factor 4 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112625331    04061 Viral protein interaction with cytokine and cytokine receptor     112625331  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     112625331  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112625331    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112625331 Cytokines and neuropeptides [BR:tge04052]  Cytokines   Chemokines    112625331 Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Chemokines    112625331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112625331 NCBI-ProteinID:  XP_025242380 Ensembl:  ENSTGEG00000014624 UniProt:  A0A8D2FAW5 LinkDB All DBs Position 5:complement(68279019..68280181) Genome browser AA seq 101 aa AA seqDB search MSSAARSRATYPEMLFLALLLLPVVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLRNGRKICLDLQAPLYKKIIKKHLER NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagctccgcagccaggtcccgcgccacctacccggagatgctgttcctggcgttgctg ctcctgccagttgtggtcgccttcgccagcgctgaagctgaagaagacggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaggaatggaagg aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacatttggag cgttag

DBGET integrated database retrieval system