Theropithecus gelada (gelada): 112626443 Help Entry 112626443         CDS       T08041                                  Symbol IL13 Name (RefSeq) interleukin-13 isoform X1   KO K05435   interleukin 13 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04630   JAK-STAT signaling pathway tge04657   IL-17 signaling pathway tge04658   Th1 and Th2 cell differentiation tge04664   Fc epsilon RI signaling pathway tge05200   Pathways in cancer tge05310   Asthma tge05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112626443 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112626443 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     112626443 (IL13)    04657 IL-17 signaling pathway     112626443 (IL13)    04664 Fc epsilon RI signaling pathway     112626443 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112626443 (IL13)   09163 Immune disease    05310 Asthma     112626443 (IL13)    05321 Inflammatory bowel disease     112626443 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112626443 (IL13) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interleukins    112626443 (IL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  112626443 NCBI-ProteinID:  XP_025244315 Ensembl:  ENSTGEG00000018976 UniProt:  A0A8D2FJ54 LinkDB All DBs Position 6:129050627..129055487 Genome browser AA seq 146 aa AA seqDB search MRPLLNPLLLALGLMALLLTMVIALTCLGGFASPSPVPPSTALRELIEELVNITQNQKAP LCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRD TKIEVAQFVKDLLLHLKKLFREGQFN NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcgtccgctcctcaatcctctcctgttggcactgggcctcatggcgctcttgttgacc atggtcattgctctcacttgcctcggcggctttgcctccccaagccctgtgcctccctct acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggccccg ctctgcaatggcagcatggtgtggagcatcaacctgacagctggcgtgtactgtgcagcc ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg aacggattctgcccgcacaaggtctcagctgggcagttttccagcttgcgtgtccgagac accaaaatcgaggtggcccagtttgtaaaggatctgctcttacatttaaagaaacttttt cgcgagggacagttcaactga

DBGET integrated database retrieval system