Theropithecus gelada (gelada): 112626632 Help Entry 112626632         CDS       T08041                                  Symbol IL3 Name (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04151   PI3K-Akt signaling pathway tge04210   Apoptosis tge04630   JAK-STAT signaling pathway tge04640   Hematopoietic cell lineage tge04664   Fc epsilon RI signaling pathway tge05200   Pathways in cancer tge05202   Transcriptional misregulation in cancer tge05221   Acute myeloid leukemia tge05310   Asthma Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112626632 (IL3)    04151 PI3K-Akt signaling pathway     112626632 (IL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112626632 (IL3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112626632 (IL3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112626632 (IL3)    04664 Fc epsilon RI signaling pathway     112626632 (IL3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112626632 (IL3)    05202 Transcriptional misregulation in cancer     112626632 (IL3)   09162 Cancer: specific types    05221 Acute myeloid leukemia     112626632 (IL3)   09163 Immune disease    05310 Asthma     112626632 (IL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112626632 (IL3)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112626632 (IL3) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interleukins    112626632 (IL3) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Cytokines    112626632 (IL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 UFL1 Motif Other DBs NCBI-GeneID:  112626632 NCBI-ProteinID:  XP_025244621 Ensembl:  ENSTGEG00000018533 LinkDB All DBs Position 6:128461723..128463905 Genome browser AA seq 143 aa AA seqDB search MSCLPVLLLLHLLVSPGLQAPMTQTTSLKTSWANCSNMIDEIITHLNQPPLPSPDFNDLN EEDRTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITN GDQNDFRRKLKFYLKTLENEQAQ NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagctgcctgcccgtcctgctcctgctccatctcctggtcagccccggactccaagct cccatgacccagacaacgtccttgaagacaagctgggctaactgctctaacatgatcgat gaaattataacacacttaaaccagccacctttgccttcgccggacttcaacgacctcaat gaggaagaccgaaccattctggtggaaaaaaaccttcgaaggtcaaacctggaggcattc agtaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc ccaccatgcctgcccatggccacggccgcacccacgcgacctccaatccgtatcacgaac ggtgaccagaatgacttccggaggaaactgaagttctatctgaaaacccttgagaatgag caggctcaatag

DBGET integrated database retrieval system