Theropithecus gelada (gelada): 112626790 Help Entry 112626790         CDS       T08041                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism tge  Theropithecus gelada (gelada) Pathway tge04015   Rap1 signaling pathway tge04810   Regulation of actin cytoskeleton tge05014   Amyotrophic lateral sclerosis tge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112626790 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112626790 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112626790 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112626790 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112626790 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tge04812]     112626790 (PFN3)    04147 Exosome [BR:tge04147]     112626790 (PFN3) Membrane trafficking [BR:tge04131]  Others   Actin-binding proteins    Others     112626790 (PFN3) Cytoskeleton proteins [BR:tge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112626790 (PFN3) Exosome [BR:tge04147]  Exosomal proteins   Proteins found in most exosomes    112626790 (PFN3) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112626790 NCBI-ProteinID:  XP_025244920 Ensembl:  ENSTGEG00000015649 UniProt:  A0A8D2FDE2 LinkDB All DBs Position 6:complement(173663711..173664216) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGP NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg gctgccatctcgccgcaggaggtgggtgtgctcacggggcccgaccgttgcaccttcctg caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaagggactggacccgcgcgccgtgtgcgtg ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcccctag

DBGET integrated database retrieval system