Theropithecus gelada (gelada): 112626808 Help Entry 112626808         CDS       T08041                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism tge  Theropithecus gelada (gelada) Pathway tge00190   Oxidative phosphorylation tge01100   Metabolic pathways tge01524   Platinum drug resistance tge04115   p53 signaling pathway tge04210   Apoptosis tge04215   Apoptosis - multiple species tge04932   Non-alcoholic fatty liver disease tge05010   Alzheimer disease tge05012   Parkinson disease tge05014   Amyotrophic lateral sclerosis tge05016   Huntington disease tge05017   Spinocerebellar ataxia tge05020   Prion disease tge05022   Pathways of neurodegeneration - multiple diseases tge05132   Salmonella infection tge05134   Legionellosis tge05145   Toxoplasmosis tge05152   Tuberculosis tge05160   Hepatitis C tge05161   Hepatitis B tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05167   Kaposi sarcoma-associated herpesvirus infection tge05168   Herpes simplex virus 1 infection tge05169   Epstein-Barr virus infection tge05170   Human immunodeficiency virus 1 infection tge05200   Pathways in cancer tge05210   Colorectal cancer tge05222   Small cell lung cancer tge05416   Viral myocarditis tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     112626808  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112626808    04215 Apoptosis - multiple species     112626808    04115 p53 signaling pathway     112626808  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112626808   09162 Cancer: specific types    05210 Colorectal cancer     112626808    05222 Small cell lung cancer     112626808   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112626808    05161 Hepatitis B     112626808    05160 Hepatitis C     112626808    05164 Influenza A     112626808    05162 Measles     112626808    05168 Herpes simplex virus 1 infection     112626808    05163 Human cytomegalovirus infection     112626808    05167 Kaposi sarcoma-associated herpesvirus infection     112626808    05169 Epstein-Barr virus infection     112626808   09171 Infectious disease: bacterial    05132 Salmonella infection     112626808    05134 Legionellosis     112626808    05152 Tuberculosis     112626808   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112626808   09164 Neurodegenerative disease    05010 Alzheimer disease     112626808    05012 Parkinson disease     112626808    05014 Amyotrophic lateral sclerosis     112626808    05016 Huntington disease     112626808    05017 Spinocerebellar ataxia     112626808    05020 Prion disease     112626808    05022 Pathways of neurodegeneration - multiple diseases     112626808   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112626808    05416 Viral myocarditis     112626808   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     112626808   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112626808 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 zf-PHD-like Motif Other DBs NCBI-GeneID:  112626808 NCBI-ProteinID:  XP_025244982 LinkDB All DBs Position 1:78144754..78146095 Genome browser AA seq 151 aa AA seqDB search MFLGVLISPASLAISSQSPLRVPLTREWGCPASERESSLRQRLKRELNIGDVEKGKKIFI MKCSQCHTVEKEGKHKTGPNLHGLFGRKTGQAPEYSYTAANKNKGITWGEDTLMEYLENA KKYIPGTKMIFVGIKKNEERADLIAYLKKSY NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttcctaggtgtgctgatctccccagcctcactggctatctcttcgcagtctccttta agagttccacttacgagagagtggggatgtcctgcttcggagcgggaatcttcgttgcgc cagcgactaaaaagagaattaaatattggtgatgttgagaaaggcaagaagatttttatt atgaagtgttcccagtgccacaccgttgaaaaggaaggcaagcacaagactgggccaaat ctccatggtctcttcgggcggaagacaggtcaggcccctgaatactcttacacagccgcc aataagaacaaaggcatcacctggggagaggatacactgatggagtatttggagaatgcc aagaagtacatccctggaacaaaaatgatctttgttggcattaagaagaacgaagaaagg gcagacttgatagcttatctcaaaaaaagctactaa

DBGET integrated database retrieval system