Theropithecus gelada (gelada): 112628601 Help Entry 112628601         CDS       T08041                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism tge  Theropithecus gelada (gelada) Pathway tge04024   cAMP signaling pathway tge04062   Chemokine signaling pathway tge04064   NF-kappa B signaling pathway tge04210   Apoptosis tge04380   Osteoclast differentiation tge04620   Toll-like receptor signaling pathway tge04621   NOD-like receptor signaling pathway tge04622   RIG-I-like receptor signaling pathway tge04623   Cytosolic DNA-sensing pathway tge04625   C-type lectin receptor signaling pathway tge04657   IL-17 signaling pathway tge04658   Th1 and Th2 cell differentiation tge04659   Th17 cell differentiation tge04660   T cell receptor signaling pathway tge04662   B cell receptor signaling pathway tge04668   TNF signaling pathway tge04722   Neurotrophin signaling pathway tge04920   Adipocytokine signaling pathway tge04926   Relaxin signaling pathway tge04931   Insulin resistance tge04936   Alcoholic liver disease tge05132   Salmonella infection tge05134   Legionellosis tge05135   Yersinia infection tge05140   Leishmaniasis tge05142   Chagas disease tge05145   Toxoplasmosis tge05160   Hepatitis C tge05161   Hepatitis B tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05166   Human T-cell leukemia virus 1 infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05168   Herpes simplex virus 1 infection tge05169   Epstein-Barr virus infection tge05170   Human immunodeficiency virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05200   Pathways in cancer tge05203   Viral carcinogenesis tge05208   Chemical carcinogenesis - reactive oxygen species tge05215   Prostate cancer tge05220   Chronic myeloid leukemia tge05222   Small cell lung cancer tge05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112628601 (NFKBIA)    04668 TNF signaling pathway     112628601 (NFKBIA)    04024 cAMP signaling pathway     112628601 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112628601 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112628601 (NFKBIA)    04621 NOD-like receptor signaling pathway     112628601 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     112628601 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     112628601 (NFKBIA)    04625 C-type lectin receptor signaling pathway     112628601 (NFKBIA)    04660 T cell receptor signaling pathway     112628601 (NFKBIA)    04658 Th1 and Th2 cell differentiation     112628601 (NFKBIA)    04659 Th17 cell differentiation     112628601 (NFKBIA)    04657 IL-17 signaling pathway     112628601 (NFKBIA)    04662 B cell receptor signaling pathway     112628601 (NFKBIA)    04062 Chemokine signaling pathway     112628601 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     112628601 (NFKBIA)    04926 Relaxin signaling pathway     112628601 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112628601 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     112628601 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112628601 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     112628601 (NFKBIA)    05203 Viral carcinogenesis     112628601 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112628601 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     112628601 (NFKBIA)    05215 Prostate cancer     112628601 (NFKBIA)    05222 Small cell lung cancer     112628601 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112628601 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     112628601 (NFKBIA)    05161 Hepatitis B     112628601 (NFKBIA)    05160 Hepatitis C     112628601 (NFKBIA)    05171 Coronavirus disease - COVID-19     112628601 (NFKBIA)    05164 Influenza A     112628601 (NFKBIA)    05162 Measles     112628601 (NFKBIA)    05168 Herpes simplex virus 1 infection     112628601 (NFKBIA)    05163 Human cytomegalovirus infection     112628601 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     112628601 (NFKBIA)    05169 Epstein-Barr virus infection     112628601 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112628601 (NFKBIA)    05135 Yersinia infection     112628601 (NFKBIA)    05134 Legionellosis     112628601 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112628601 (NFKBIA)    05140 Leishmaniasis     112628601 (NFKBIA)    05142 Chagas disease     112628601 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112628601 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112628601 (NFKBIA)    04931 Insulin resistance     112628601 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tge03000]     112628601 (NFKBIA)    04131 Membrane trafficking [BR:tge04131]     112628601 (NFKBIA) Transcription factors [BR:tge03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     112628601 (NFKBIA) Membrane trafficking [BR:tge04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112628601 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  112628601 NCBI-ProteinID:  XP_025247367 Ensembl:  ENSTGEG00000002735 UniProt:  A0A8D2JV45 LinkDB All DBs Position 7b:complement(36434736..36438634) Genome browser AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggtccccgcgacgggctg aagaaggaacgactgctggacgaccgccacgacagcggcctggactccatgaaggatgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgtttctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcttggccagcgtg ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctgcacttagcctctatccacggctacctgggcattgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgacgctggaaaaccttcagatgctg ccggagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag gatgagctgccctatgacgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system