Theropithecus gelada (gelada): 112631384 Help Entry 112631384         CDS       T08041                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism tge  Theropithecus gelada (gelada) Pathway tge04014   Ras signaling pathway tge04015   Rap1 signaling pathway tge04020   Calcium signaling pathway tge04022   cGMP-PKG signaling pathway tge04024   cAMP signaling pathway tge04070   Phosphatidylinositol signaling system tge04114   Oocyte meiosis tge04218   Cellular senescence tge04261   Adrenergic signaling in cardiomyocytes tge04270   Vascular smooth muscle contraction tge04371   Apelin signaling pathway tge04625   C-type lectin receptor signaling pathway tge04713   Circadian entrainment tge04720   Long-term potentiation tge04722   Neurotrophin signaling pathway tge04728   Dopaminergic synapse tge04740   Olfactory transduction tge04744   Phototransduction tge04750   Inflammatory mediator regulation of TRP channels tge04910   Insulin signaling pathway tge04912   GnRH signaling pathway tge04915   Estrogen signaling pathway tge04916   Melanogenesis tge04921   Oxytocin signaling pathway tge04922   Glucagon signaling pathway tge04924   Renin secretion tge04925   Aldosterone synthesis and secretion tge04970   Salivary secretion tge04971   Gastric acid secretion tge05010   Alzheimer disease tge05012   Parkinson disease tge05022   Pathways of neurodegeneration - multiple diseases tge05031   Amphetamine addiction tge05034   Alcoholism tge05133   Pertussis tge05152   Tuberculosis tge05163   Human cytomegalovirus infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05170   Human immunodeficiency virus 1 infection tge05200   Pathways in cancer tge05214   Glioma tge05417   Lipid and atherosclerosis tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112631384    04015 Rap1 signaling pathway     112631384    04371 Apelin signaling pathway     112631384    04020 Calcium signaling pathway     112631384    04070 Phosphatidylinositol signaling system     112631384    04024 cAMP signaling pathway     112631384    04022 cGMP-PKG signaling pathway     112631384  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112631384    04218 Cellular senescence     112631384  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112631384   09152 Endocrine system    04910 Insulin signaling pathway     112631384    04922 Glucagon signaling pathway     112631384    04912 GnRH signaling pathway     112631384    04915 Estrogen signaling pathway     112631384    04921 Oxytocin signaling pathway     112631384    04916 Melanogenesis     112631384    04924 Renin secretion     112631384    04925 Aldosterone synthesis and secretion     112631384   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112631384    04270 Vascular smooth muscle contraction     112631384   09154 Digestive system    04970 Salivary secretion     112631384    04971 Gastric acid secretion     112631384   09156 Nervous system    04728 Dopaminergic synapse     112631384    04720 Long-term potentiation     112631384    04722 Neurotrophin signaling pathway     112631384   09157 Sensory system    04744 Phototransduction     112631384    04740 Olfactory transduction     112631384    04750 Inflammatory mediator regulation of TRP channels     112631384   09159 Environmental adaptation    04713 Circadian entrainment     112631384  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112631384   09162 Cancer: specific types    05214 Glioma     112631384   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112631384    05163 Human cytomegalovirus infection     112631384    05167 Kaposi sarcoma-associated herpesvirus infection     112631384   09171 Infectious disease: bacterial    05133 Pertussis     112631384    05152 Tuberculosis     112631384   09164 Neurodegenerative disease    05010 Alzheimer disease     112631384    05012 Parkinson disease     112631384    05022 Pathways of neurodegeneration - multiple diseases     112631384   09165 Substance dependence    05031 Amphetamine addiction     112631384    05034 Alcoholism     112631384   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112631384    05418 Fluid shear stress and atherosclerosis     112631384  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tge01009]     112631384   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tge04131]     112631384    03036 Chromosome and associated proteins [BR:tge03036]     112631384   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112631384 Protein phosphatases and associated proteins [BR:tge01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112631384 Membrane trafficking [BR:tge04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112631384 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112631384 Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112631384 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 EFhand_Ca_insen Dockerin_1 DUF1103 TerB DUF5580_M FCaBP_EF-hand Poly_export SPEF2_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  112631384 NCBI-ProteinID:  XP_025252241 LinkDB All DBs Position 9:complement(124046362..124054239) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVRRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgaccgaagagcagattgcagaattcaaagaagctttttcactattt gacaaagatggtgatggaactataacaacaaaggaattgggaactgtaaggaggtctctt gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgacttccctgaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggcaatggctat attagtgctgcagaacttcgccatgtgatgacaaaccttggagagaagttaacagatgaa gaagttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system