Theropithecus gelada (gelada): 112632064 Help Entry 112632064         CDS       T08041                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism tge  Theropithecus gelada (gelada) Pathway tge04613   Neutrophil extracellular trap formation tge05034   Alcoholism tge05202   Transcriptional misregulation in cancer tge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112632064  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112632064   09163 Immune disease    05322 Systemic lupus erythematosus     112632064   09165 Substance dependence    05034 Alcoholism     112632064  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tge03036]     112632064   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tge04147]     112632064 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112632064 Exosome [BR:tge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112632064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S Motif Other DBs NCBI-GeneID:  112632064 NCBI-ProteinID:  XP_025253490 Ensembl:  ENSTGEG00000011281 UniProt:  A0A8D2JZX9 LinkDB All DBs Position 9:91661250..91661980 Genome browser AA seq 136 aa AA seqDB search MAHTKQTACKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALCEIRSYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNPCAIHAKCVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcatacaaagcagactgcctgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgtaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcgctctgtgaaattagaagttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaacccgtgtgctatccatgccaaatgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system