KEGG   Theropithecus gelada (gelada): 112632792
Entry
112632792         CDS       T08041                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tge  Theropithecus gelada (gelada)
Pathway
tge01521  EGFR tyrosine kinase inhibitor resistance
tge01522  Endocrine resistance
tge01524  Platinum drug resistance
tge04010  MAPK signaling pathway
tge04012  ErbB signaling pathway
tge04014  Ras signaling pathway
tge04015  Rap1 signaling pathway
tge04022  cGMP-PKG signaling pathway
tge04024  cAMP signaling pathway
tge04062  Chemokine signaling pathway
tge04066  HIF-1 signaling pathway
tge04068  FoxO signaling pathway
tge04071  Sphingolipid signaling pathway
tge04072  Phospholipase D signaling pathway
tge04114  Oocyte meiosis
tge04140  Autophagy - animal
tge04148  Efferocytosis
tge04150  mTOR signaling pathway
tge04151  PI3K-Akt signaling pathway
tge04210  Apoptosis
tge04218  Cellular senescence
tge04261  Adrenergic signaling in cardiomyocytes
tge04270  Vascular smooth muscle contraction
tge04350  TGF-beta signaling pathway
tge04360  Axon guidance
tge04370  VEGF signaling pathway
tge04371  Apelin signaling pathway
tge04380  Osteoclast differentiation
tge04510  Focal adhesion
tge04517  IgSF CAM signaling
tge04520  Adherens junction
tge04540  Gap junction
tge04550  Signaling pathways regulating pluripotency of stem cells
tge04611  Platelet activation
tge04613  Neutrophil extracellular trap formation
tge04620  Toll-like receptor signaling pathway
tge04621  NOD-like receptor signaling pathway
tge04625  C-type lectin receptor signaling pathway
tge04650  Natural killer cell mediated cytotoxicity
tge04657  IL-17 signaling pathway
tge04658  Th1 and Th2 cell differentiation
tge04659  Th17 cell differentiation
tge04660  T cell receptor signaling pathway
tge04662  B cell receptor signaling pathway
tge04664  Fc epsilon RI signaling pathway
tge04666  Fc gamma R-mediated phagocytosis
tge04668  TNF signaling pathway
tge04713  Circadian entrainment
tge04720  Long-term potentiation
tge04722  Neurotrophin signaling pathway
tge04723  Retrograde endocannabinoid signaling
tge04724  Glutamatergic synapse
tge04725  Cholinergic synapse
tge04726  Serotonergic synapse
tge04730  Long-term depression
tge04810  Regulation of actin cytoskeleton
tge04910  Insulin signaling pathway
tge04912  GnRH signaling pathway
tge04914  Progesterone-mediated oocyte maturation
tge04915  Estrogen signaling pathway
tge04916  Melanogenesis
tge04917  Prolactin signaling pathway
tge04919  Thyroid hormone signaling pathway
tge04921  Oxytocin signaling pathway
tge04926  Relaxin signaling pathway
tge04928  Parathyroid hormone synthesis, secretion and action
tge04929  GnRH secretion
tge04930  Type II diabetes mellitus
tge04933  AGE-RAGE signaling pathway in diabetic complications
tge04934  Cushing syndrome
tge04935  Growth hormone synthesis, secretion and action
tge04960  Aldosterone-regulated sodium reabsorption
tge05010  Alzheimer disease
tge05020  Prion disease
tge05022  Pathways of neurodegeneration - multiple diseases
tge05034  Alcoholism
tge05132  Salmonella infection
tge05133  Pertussis
tge05135  Yersinia infection
tge05140  Leishmaniasis
tge05142  Chagas disease
tge05145  Toxoplasmosis
tge05152  Tuberculosis
tge05160  Hepatitis C
tge05161  Hepatitis B
tge05163  Human cytomegalovirus infection
tge05164  Influenza A
tge05165  Human papillomavirus infection
tge05166  Human T-cell leukemia virus 1 infection
tge05167  Kaposi sarcoma-associated herpesvirus infection
tge05170  Human immunodeficiency virus 1 infection
tge05171  Coronavirus disease - COVID-19
tge05200  Pathways in cancer
tge05203  Viral carcinogenesis
tge05205  Proteoglycans in cancer
tge05206  MicroRNAs in cancer
tge05207  Chemical carcinogenesis - receptor activation
tge05208  Chemical carcinogenesis - reactive oxygen species
tge05210  Colorectal cancer
tge05211  Renal cell carcinoma
tge05212  Pancreatic cancer
tge05213  Endometrial cancer
tge05214  Glioma
tge05215  Prostate cancer
tge05216  Thyroid cancer
tge05218  Melanoma
tge05219  Bladder cancer
tge05220  Chronic myeloid leukemia
tge05221  Acute myeloid leukemia
tge05223  Non-small cell lung cancer
tge05224  Breast cancer
tge05225  Hepatocellular carcinoma
tge05226  Gastric cancer
tge05230  Central carbon metabolism in cancer
tge05231  Choline metabolism in cancer
tge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tge05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112632792 (MAPK1)
   04012 ErbB signaling pathway
    112632792 (MAPK1)
   04014 Ras signaling pathway
    112632792 (MAPK1)
   04015 Rap1 signaling pathway
    112632792 (MAPK1)
   04350 TGF-beta signaling pathway
    112632792 (MAPK1)
   04370 VEGF signaling pathway
    112632792 (MAPK1)
   04371 Apelin signaling pathway
    112632792 (MAPK1)
   04668 TNF signaling pathway
    112632792 (MAPK1)
   04066 HIF-1 signaling pathway
    112632792 (MAPK1)
   04068 FoxO signaling pathway
    112632792 (MAPK1)
   04072 Phospholipase D signaling pathway
    112632792 (MAPK1)
   04071 Sphingolipid signaling pathway
    112632792 (MAPK1)
   04024 cAMP signaling pathway
    112632792 (MAPK1)
   04022 cGMP-PKG signaling pathway
    112632792 (MAPK1)
   04151 PI3K-Akt signaling pathway
    112632792 (MAPK1)
   04150 mTOR signaling pathway
    112632792 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    112632792 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112632792 (MAPK1)
   04148 Efferocytosis
    112632792 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112632792 (MAPK1)
   04210 Apoptosis
    112632792 (MAPK1)
   04218 Cellular senescence
    112632792 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112632792 (MAPK1)
   04520 Adherens junction
    112632792 (MAPK1)
   04540 Gap junction
    112632792 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112632792 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112632792 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112632792 (MAPK1)
   04613 Neutrophil extracellular trap formation
    112632792 (MAPK1)
   04620 Toll-like receptor signaling pathway
    112632792 (MAPK1)
   04621 NOD-like receptor signaling pathway
    112632792 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    112632792 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    112632792 (MAPK1)
   04660 T cell receptor signaling pathway
    112632792 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    112632792 (MAPK1)
   04659 Th17 cell differentiation
    112632792 (MAPK1)
   04657 IL-17 signaling pathway
    112632792 (MAPK1)
   04662 B cell receptor signaling pathway
    112632792 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    112632792 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    112632792 (MAPK1)
   04062 Chemokine signaling pathway
    112632792 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112632792 (MAPK1)
   04929 GnRH secretion
    112632792 (MAPK1)
   04912 GnRH signaling pathway
    112632792 (MAPK1)
   04915 Estrogen signaling pathway
    112632792 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    112632792 (MAPK1)
   04917 Prolactin signaling pathway
    112632792 (MAPK1)
   04921 Oxytocin signaling pathway
    112632792 (MAPK1)
   04926 Relaxin signaling pathway
    112632792 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    112632792 (MAPK1)
   04919 Thyroid hormone signaling pathway
    112632792 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    112632792 (MAPK1)
   04916 Melanogenesis
    112632792 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112632792 (MAPK1)
   04270 Vascular smooth muscle contraction
    112632792 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112632792 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112632792 (MAPK1)
   04725 Cholinergic synapse
    112632792 (MAPK1)
   04726 Serotonergic synapse
    112632792 (MAPK1)
   04720 Long-term potentiation
    112632792 (MAPK1)
   04730 Long-term depression
    112632792 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    112632792 (MAPK1)
   04722 Neurotrophin signaling pathway
    112632792 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    112632792 (MAPK1)
   04380 Osteoclast differentiation
    112632792 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112632792 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112632792 (MAPK1)
   05206 MicroRNAs in cancer
    112632792 (MAPK1)
   05205 Proteoglycans in cancer
    112632792 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    112632792 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    112632792 (MAPK1)
   05203 Viral carcinogenesis
    112632792 (MAPK1)
   05230 Central carbon metabolism in cancer
    112632792 (MAPK1)
   05231 Choline metabolism in cancer
    112632792 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112632792 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112632792 (MAPK1)
   05212 Pancreatic cancer
    112632792 (MAPK1)
   05225 Hepatocellular carcinoma
    112632792 (MAPK1)
   05226 Gastric cancer
    112632792 (MAPK1)
   05214 Glioma
    112632792 (MAPK1)
   05216 Thyroid cancer
    112632792 (MAPK1)
   05221 Acute myeloid leukemia
    112632792 (MAPK1)
   05220 Chronic myeloid leukemia
    112632792 (MAPK1)
   05218 Melanoma
    112632792 (MAPK1)
   05211 Renal cell carcinoma
    112632792 (MAPK1)
   05219 Bladder cancer
    112632792 (MAPK1)
   05215 Prostate cancer
    112632792 (MAPK1)
   05213 Endometrial cancer
    112632792 (MAPK1)
   05224 Breast cancer
    112632792 (MAPK1)
   05223 Non-small cell lung cancer
    112632792 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112632792 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    112632792 (MAPK1)
   05161 Hepatitis B
    112632792 (MAPK1)
   05160 Hepatitis C
    112632792 (MAPK1)
   05171 Coronavirus disease - COVID-19
    112632792 (MAPK1)
   05164 Influenza A
    112632792 (MAPK1)
   05163 Human cytomegalovirus infection
    112632792 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112632792 (MAPK1)
   05165 Human papillomavirus infection
    112632792 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112632792 (MAPK1)
   05135 Yersinia infection
    112632792 (MAPK1)
   05133 Pertussis
    112632792 (MAPK1)
   05152 Tuberculosis
    112632792 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112632792 (MAPK1)
   05140 Leishmaniasis
    112632792 (MAPK1)
   05142 Chagas disease
    112632792 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112632792 (MAPK1)
   05020 Prion disease
    112632792 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    112632792 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    112632792 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112632792 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112632792 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112632792 (MAPK1)
   04934 Cushing syndrome
    112632792 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112632792 (MAPK1)
   01524 Platinum drug resistance
    112632792 (MAPK1)
   01522 Endocrine resistance
    112632792 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tge01001]
    112632792 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tge03036]
    112632792 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tge04147]
    112632792 (MAPK1)
Enzymes [BR:tge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112632792 (MAPK1)
Protein kinases [BR:tge01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112632792 (MAPK1)
Chromosome and associated proteins [BR:tge03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112632792 (MAPK1)
Exosome [BR:tge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112632792 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 112632792
NCBI-ProteinID: XP_025254599
Ensembl: ENSTGEG00000006646
UniProt: A0A8D2EQJ8
LinkDB
Position
10:complement(33666214..33774332)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtgggaccgcgctacaccaacctctcgtacatcggcgagggtgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgcgggagataaaaatcttgctgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaagacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggctacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgacatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccattgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactgatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system