Theropithecus gelada (gelada): 112633476 Help Entry 112633476         CDS       T08041                                  Symbol GHRH Name (RefSeq) somatoliberin isoform X1   KO K05260   growth hormone-releasing hormone Organism tge  Theropithecus gelada (gelada) Pathway tge04080   Neuroactive ligand-receptor interaction tge04081   Hormone signaling tge04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112633476 (GHRH)    04081 Hormone signaling     112633476 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     112633476 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112633476 (GHRH) Cytokines and neuropeptides [BR:tge04052]  Neuropeptides   GPCR binding    112633476 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  112633476 NCBI-ProteinID:  XP_025255923 Ensembl:  ENSTGEG00000001405 UniProt:  A0A8D2E7W1 LinkDB All DBs Position 10:65384863..65395981 Genome browser AA seq 108 aa AA seqDB search MPLWVFFFVILTLSSSSHCSPSPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR QQGERNQERGARARLGRQVDSVWAEQKQMELESILVALLQKHSRNSQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttctttgtgatcctcaccctcagcagcagctcccactgctcc ccatctccccctttgactctcaggatgcggcggtatgcagatgccatcttcaccaacagc taccggaaggtgctgggccagctgtccgcccgcaagctgctccaagacatcatgagcagg cagcagggagagagaaaccaagagcgaggagcaagggcacggcttggccggcaggtggac agcgtgtgggcagaacaaaagcaaatggaattggagagcattctggtggccctgctgcag aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system