Theropithecus gelada (gelada): 112634881 Help Entry 112634881         CDS       T08041                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism tge  Theropithecus gelada (gelada) Pathway tge04613   Neutrophil extracellular trap formation tge05034   Alcoholism tge05203   Viral carcinogenesis tge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:tge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112634881  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112634881   09163 Immune disease    05322 Systemic lupus erythematosus     112634881   09165 Substance dependence    05034 Alcoholism     112634881  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tge03036]     112634881 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112634881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  112634881 NCBI-ProteinID:  XP_025258538 Ensembl:  ENSTGEG00000022798 UniProt:  A0A8D2FYF4 LinkDB All DBs Position 11:complement(108764977..108767316) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgcggtaaaggcggcaaggggctgggtaagggaggcgccaagcgccaccgg aaggtgttgcgggacaatatccaaggcattacaaagcccgcgattcgccgtctcgcccga cgtgggggcgtcaagcgcatctctggtctcatctacgaggagacccggggagtcctcaaa gtcttcctggagaacgtgatccgcgacgcggtgacttacacggagcacgccaagcgcaag accgtcactgccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctctatggt ttcggcggctga

DBGET integrated database retrieval system