Thermococcus gorgonarius: A3K92_06800 Help Entry A3K92_06800       CDS       T05047                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tgg  Thermococcus gorgonarius Pathway tgg03010   Ribosome Brite KEGG Orthology (KO) [BR:tgg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3K92_06800   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3K92_06800  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tgg03011]     A3K92_06800    04121 Ubiquitin system [BR:tgg04121]     A3K92_06800   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgg04147]     A3K92_06800 Ribosome [BR:tgg03011]  Ribosomal proteins   Eukaryotes    Small subunit     A3K92_06800   Archaea     A3K92_06800 Ubiquitin system [BR:tgg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3K92_06800 Exosome [BR:tgg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    A3K92_06800   Exosomal proteins of colorectal cancer cells    A3K92_06800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Ribosomal_L37e Zn_ribbon_RPB9 Cas12f1-like_TNB GFA Lar_restr_allev Zn_ribbon_NUD MqsA_antitoxin Zn_ribbon_Nudix Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  ASJ01209 UniProt:  A0A2Z2M7E9 LinkDB All DBs Position complement(1231747..1231917) Genome browser AA seq 56 aa AA seqDB search MAKKKKTSQKWKLYEVKGGKVVRKNKFCPRCGPGVFMANHKDRWSCGRCGYTEWKK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggccaagaagaaaaagaccagccagaagtggaagctctacgaggtcaagggcggtaag gtcgtcaggaagaacaagttctgcccgcgctgtgggccgggcgttttcatggccaaccac aaggaccgctggagctgcggccgctgcggctacacagagtggaagaagtga

DBGET integrated database retrieval system